WAP four-disulfide core domain protein 12

experimental

Also known as: Putative protease inhibitor WAP12, Whey acidic protein 2, WFDC12, Q8WWY7

**Mechanism of Action** WAP four-disulfide core domain protein 12 (WFDC12) is a member of the whey acidic protein (WAP) family, characterized by a conserved four-disulfide core (WFDC) domain. This structural motif is associated with protease inhibitory activity, particularly against serine proteases. WFDC12 is predicted to function as an acid-stable proteinase inhibitor, potentially contributing to antimicrobial defense by neutralizing microbial proteases or directly disrupting bacterial membranes. Its expression is enriched in mucosal tissues, suggesting a role in innate immunity. **Key Research Findings** No peer-reviewed research publications on WFDC12 were identified in PubMed as of the current date. The protein is classified as experimental, with functional annotations derived primarily from sequence homology to other WFDC family members (e.g., SLPI, elafin). Its putative antibacterial and protease-inhibitory activities remain unvalidated in vitro or in vivo. **Clinical Relevance** Given the absence of published studies, WFDC12 has no established clinical relevance. Its potential as a therapeutic target or biomarker for infectious or inflammatory diseases is speculative and requires further investigation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK
Molecular weight
12050 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, disulfide-bond, protease-inhibitor, proteomics-identification, reference-proteome, secreted, serine-protease-inhibitor, signal

Mechanism of action

Antibacterial protein. Putative acid-stable proteinase inhibitor

Frequently asked questions

What is WAP four-disulfide core domain protein 12?

**Mechanism of Action** WAP four-disulfide core domain protein 12 (WFDC12) is a member of the whey acidic protein (WAP) family, characterized by a conserved four-disulfide core (WFDC) domain. This structural motif is associated with protease inhibitory activity, particularly against serine proteases. WFDC12 is predicte

How does WAP four-disulfide core domain protein 12 work?

Antibacterial protein. Putative acid-stable proteinase inhibitor

What is the research status of WAP four-disulfide core domain protein 12?

WAP four-disulfide core domain protein 12 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of WAP four-disulfide core domain protein 12?

WAP four-disulfide core domain protein 12 has a molecular weight of approximately 12050 g/mol.

Related peptides

Build on WAP four-disulfide core domain protein 12 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key