Beta-defensin 1

experimental

Also known as: Defensin, beta 1, DEFB1, P60022

Beta-defensin 1 (DEFB1) is an antimicrobial peptide with a primary mechanism involving direct bactericidal activity against Gram-positive and Gram-negative bacteria through membrane disruption. It also functions as a ligand for C-C chemokine receptor 6 (CCR6), triggering intracellular calcium mobilization and downstream signaling. This CCR6-dependent pathway has been shown to positively regulate sperm motility and enhance bactericidal activity, suggesting a dual role in host defense and reproductive physiology. Key research findings indicate that DEFB1 expression is constitutive in epithelial tissues, including the respiratory and urogenital tracts, contributing to mucosal immunity. Studies have linked polymorphisms in the DEFB1 gene to altered susceptibility to infections, such as chronic obstructive pulmonary disease and cystic fibrosis exacerbations. Additionally, its role in sperm function highlights potential implications for male fertility, with evidence that DEFB1-mediated CCR6 signaling supports sperm capacitation and motility. Clinically, DEFB1 is under investigation as a biomarker for infection risk and as a therapeutic target for enhancing innate immunity. Its antimicrobial properties and chemotactic activity via CCR6 position it as a candidate for developing novel anti-infective agents, particularly in contexts of antibiotic resistance. However, its experimental status limits current clinical applications. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Molecular weight
7420 g/mol
Research status
experimental
References
651
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, defensin, direct-protein-sequencing, disulfide-bond, membrane, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed:25122636)

Research & studies

AhR-Dependent Induction of β-Defensin 1 in Colonic Epithelial Cells Regulates Cross-Talk between Gut Microbiota and Immune Response Leading to Attenuation of Colitis
Advanced science (Weinheim, Baden-Wurttemberg, Germany) · 2025 · PubMed
Beta-defensin 1 knockdown ameliorates the characteristics of intervertebral disc degeneration by altering nucleus pulposus and annulus fibrosus cell phenotypes via suppression of the extracellular signal-regulated kinase signaling pathway
Osteoarthritis and cartilage · 2025 · PubMed

DEFB1 expression was higher in degenerated human and rat IVD tissues compared to non-degenerated samples.; DEFB1 knockdown increased cell viability and decreased senescence, apoptosis, and G1-phase arrest in NP and AF cells under IL-1 stimulation.; DEFB1 knockdown reduced ERK1/2 phosphorylation in vivo and in vitro, and an ERK antagonist reversed the effects of DEFB1 overexpression.; Targeting DEFB1 may offer a therapeutic strategy for IDD by modulating ERK signaling.

Incorporation of human β-defensin-1 into immunoliposomes to facilitate targeted autophagy therapy of colon carcinoma
World journal of clinical oncology · 2025 · PubMed
Human β-defensin-1 activates autophagy in human colon cancer cells via regulation of long non-coding RNA TCONS_00014506
World journal of gastrointestinal oncology · 2024 · PubMed

Human β-defensin-1 reduced proliferation of colon cancer cells.; Autophagy activation was associated with inhibition of mammalian target of rapamycin.; Increased Beclin1 and LC3II/I proteins indicated autophagy activation.; Upregulation of long non-coding RNA TCONS_00014506 mediated the autophagy activation.

The Role of β-Defensin 1 Against Porphyromonas gingivalis Lipopolysaccharide-Mediated Inflammation in the THP-1 Cell Line
Cureus · 2023 · PubMed
Chicken β-defensin-1 peptide as a candidate anticoccidial agent in broiler chickens
Animal biotechnology · 2023 · PubMed
Human beta-defensin 1 circulating level and gene polymorphism in non-segmental vitiligo Egyptian patients
Anais brasileiros de dermatologia · 2023 · PubMed
Butyrate producers, "The Sentinel of Gut": Their intestinal significance with and beyond butyrate, and prospective use as microbial therapeutics
Frontiers in microbiology · 2023 · PubMed

Frequently asked questions

What is Beta-defensin 1?

Beta-defensin 1 (DEFB1) is an antimicrobial peptide with a primary mechanism involving direct bactericidal activity against Gram-positive and Gram-negative bacteria through membrane disruption. It also functions as a ligand for C-C chemokine receptor 6 (CCR6), triggering intracellular calcium mobilization and downstrea

How does Beta-defensin 1 work?

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed:25122636)

What is the research status of Beta-defensin 1?

Beta-defensin 1 is currently classified as experimental, with 651 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 1?

Beta-defensin 1 has a molecular weight of approximately 7420 g/mol.

Related peptides

Build on Beta-defensin 1 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key