Hepcidin
experimentalAlso known as: Liver-expressed antimicrobial peptide 1, Putative liver tumor regressor, HAMP, P81172
**Mechanism of Action** Hepcidin, encoded by the *HAMP* gene, is a 25-amino-acid peptide hormone primarily synthesized in the liver. It functions as the master regulator of systemic iron homeostasis by binding to the iron exporter ferroportin on enterocytes, macrophages, and hepatocytes. This binding induces ferroportin internalization and degradation, thereby reducing dietary iron absorption from the duodenum and limiting iron release from storage sites (e.g., splenic macrophages) into the plasma. Hepcidin expression is upregulated by iron overload and inflammation (via IL-6/STAT3 signaling) and suppressed by hypoxia, erythropoietic demand, and iron deficiency (via the BMP/SMAD and HFE/TfR2 pathways). **Key Research Findings** Preclinical and clinical studies have established hepcidin dysregulation as central to multiple iron disorders. In hereditary hemochromatosis, *HAMP* mutations or defective upstream regulators (e.g., *HFE*, *TFR2*, *HJV*) cause hepcidin deficiency, leading to uncontrolled iron absorption and parenchymal iron overload. Conversely, hepcidin excess is implicated in anemia of chronic disease (ACD), where inflammatory cytokines drive sustained hepcidin elevation, causing functional iron deficiency and hypoferremia. Experimental models demonstrate that hepcidin agonists (e.g., minihepcidins) can correct iron overload in hemochromatosis, while antagonists (e.g., anti-hepcidin antibodies, LDN-193189) improve iron availability in ACD. Over 6,400 PubMed-indexed studies support these mechanisms, though no hepcidin-based therapies have yet received regulatory approval. **Clinical Relevance** Hepcidin is a validated biomarker for diagnosing iron disorders (e.g., distinguishing iron-deficiency anemia from ACD) and a therapeutic target for conditions such as hemochromatosis, β-thalassemia, and myelodysplastic syndromes. Clinical trials are evaluating hepcidin analogs (e.g., LJPC-401) for iron overload and hepcidin inhibitors (e.g., LY2787106) for anemia. However, challenges remain, including off-target effects on infection susceptibility (due to ferroportin’s role in macrophage iron retention) and the need for precise dosing to avoid iatrogenic iron deficiency or overload. For research purposes only — not medical advice.
Key data
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKTC113H170N34O31S9Mechanism of action
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PubMed:22682227, PubMed:29237594, PubMed:32814342). Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes (PubMed:22306005)
Research & studies
Hepcidin regulates iron by controlling the cellular iron exporter ferroportin.; Plasma hepcidin increases with iron loading and inflammation, and decreases with erythropoietic stimulation and pregnancy.; Hepcidin deficiency causes iron overload in hemochromatosis and anemias with ineffective erythropoiesis.; Hepcidin excess leads to iron-restrictive anemias, including anemia of inflammation.
Frequently asked questions
What is Hepcidin?
**Mechanism of Action** Hepcidin, encoded by the *HAMP* gene, is a 25-amino-acid peptide hormone primarily synthesized in the liver. It functions as the master regulator of systemic iron homeostasis by binding to the iron exporter ferroportin on enterocytes, macrophages, and hepatocytes. This binding induces ferroporti
How does Hepcidin work?
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues. Acts by promoting endocytosis and degradation of ferroportin/SLC40A1, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma (PubMed:22682227, PubMed:29237594, PubMed:32814342). Controls the major flows of iron into plasma: absorption o
What is the research status of Hepcidin?
Hepcidin is currently classified as experimental, with 6,462 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Hepcidin?
Hepcidin has a molecular weight of approximately 2789.4 g/mol (formula C113H170N34O31S9).
Related peptides
Human cathelicidin antimicrobial peptide with broad-spectrum antibacterial, immunomodulatory, and wound-healing activity.
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization i…
Antimicrobial protein that kills intracellular pathogens.
28-aa thymic peptide that enhances T-cell maturation and TLR signaling; approved in many countries for hepatitis and as an immune adjuvant.
Zinc-dependent thymic nonapeptide that regulates T-cell differentiation and has analgesic and anti-inflammatory effects.
Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents
Build on Hepcidin data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key