Small proline-rich protein 2A

experimental

Also known as: 2-1, SPRR2A, P35326

Small proline-rich protein 2A (SPRR2A), also known as 2-1, is a gut-derived bactericidal peptide that selectively targets Gram-positive bacteria. Its mechanism of action involves electrostatic binding to negatively charged lipids on bacterial membranes, which induces membrane permeabilization and disruption, leading to bacterial cell death. This selectivity is attributed to the peptide's affinity for specific lipid compositions characteristic of Gram-positive bacterial envelopes. Current research, supported by 24 PubMed references, remains at an experimental stage. Key findings indicate that SPRR2A is expressed in intestinal epithelial cells and contributes to host defense by modulating the gut microbiome composition. Studies have demonstrated its efficacy against pathogenic Gram-positive bacteria such as *Enterococcus faecalis* and *Listeria monocytogenes*, while sparing commensal flora. The peptide's activity is pH-dependent and influenced by the presence of bile salts, suggesting a role in maintaining intestinal homeostasis. Clinically, SPRR2A holds potential as a narrow-spectrum antimicrobial agent for treating Gram-positive infections, particularly in the gastrointestinal tract. Its targeted mechanism may reduce collateral damage to the microbiome compared to broad-spectrum antibiotics. However, no clinical trials have been conducted, and therapeutic applications remain hypothetical pending further validation of safety, stability, and in vivo efficacy. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK
Molecular weight
7965 g/mol
Research status
experimental
References
24
Tags
uniprot, antibiotic, antimicrobial, cytoplasmic-vesicle, disulfide-bond, lipid-binding, proteomics-identification, reference-proteome, repeat, secreted

Mechanism of action

Gut bactericidal protein that selectively kills Gram-positive bacteria by binding to negatively charged lipids on bacterial membranes, leading to bacterial membrane permeabilization and disruption (PubMed:34735226). Specifically binds lipids bearing negatively charged headgroups, such as phosphatidic acid, phosphatidylserine (PS), cardiolipin (CL), and phosphatidylinositol phosphates, but not to zwitterionic or neutral lipids (PubMed:34735226). Induced by type-2 cytokines in response to helminth infection and is required to protect against helminth-induced bacterial invasion of intestinal tissue (By similarity). May also be involved in the development of the cornified envelope of squamous epithelia; however, additional evidences are required to confirm this result in vivo (PubMed:8325635)

Research & studies

Engineered Bacterial Biosynthesis of a Cysteine-Rich SPRR2A Fusion Protein with Dual Antibacterial and Anticancer Efficacy
ACS synthetic biology · 2026 · PubMed
Small proline-rich protein 2A drives epithelial remodeling in eosinophilic chronic rhinosinusitis with nasal polyps via SAA2 upregulation
The Journal of allergy and clinical immunology · 2025 · PubMed

SPRR2A expression is significantly elevated in eCRSwNP nasal tissues and correlates with eosinophil infiltration, epithelial thickness, and IL-13 levels.; Sprr2a knockout mice show reduced epithelial thickness, fewer nasal polyps, lower IL-4/IL-13 levels, and attenuated epithelial-mesenchymal transition.; SAA2 (human) is upregulated in eCRSwNP and positively correlates with SPRR2A; Saa3 induces EMT and barrier dysfunction in vitro.

S100A9 induces tissue remodeling of human nasal epithelium in chronic rhinosinusitis with nasal polyp
International forum of allergy & rhinology · 2025 · PubMed
Development and validation of a prediction model for gastric cancer: a single-center prospective study
Laboratory medicine · 2025 · PubMed
Small proline-rich protein 2A is a gut bactericidal protein deployed during helminth infection
Science (New York, N.Y.) · 2021 · PubMed

SPRR2A is phylogenetically unrelated to known mammalian antimicrobial proteins.; SPRR2A selectively kills Gram-positive bacteria by disrupting their membranes.; SPRR2A shapes gut microbiota, restricts bacterial surface association, and protects against Listeria monocytogenes.; SPRR2A is induced by type 2 cytokines during helminth infection and prevents helminth-induced bacterial invasion.

A helminth-induced antimicrobial protein
Science (New York, N.Y.) · 2021 · PubMed

Helminth infection induces expression of SPRR2A in the intestine.; SPRR2A functions as an antimicrobial protein.; SPRR2A regulates the composition of the intestinal microbiota.

Small Proline-Rich Protein 2A and 2D Are Regulated by the RBM38-p73 Axis and Associated with p73-Dependent Suppression of Chronic Inflammation
Cancers · 2021 · PubMed
Serum Small Proline-Rich Protein 2A (SPRR2A) Is a Noninvasive Biomarker in Gastric Cancer
Disease markers · 2020 · PubMed

Frequently asked questions

What is Small proline-rich protein 2A?

Small proline-rich protein 2A (SPRR2A), also known as 2-1, is a gut-derived bactericidal peptide that selectively targets Gram-positive bacteria. Its mechanism of action involves electrostatic binding to negatively charged lipids on bacterial membranes, which induces membrane permeabilization and disruption, leading to

How does Small proline-rich protein 2A work?

Gut bactericidal protein that selectively kills Gram-positive bacteria by binding to negatively charged lipids on bacterial membranes, leading to bacterial membrane permeabilization and disruption (PubMed:34735226). Specifically binds lipids bearing negatively charged headgroups, such as phosphatidic acid, phosphatidylserine (PS), cardiolipin (CL), and phosphatidylinositol phosphates, but not to z

What is the research status of Small proline-rich protein 2A?

Small proline-rich protein 2A is currently classified as experimental, with 24 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Small proline-rich protein 2A?

Small proline-rich protein 2A has a molecular weight of approximately 7965 g/mol.

Related peptides

Build on Small proline-rich protein 2A data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key