Ribonuclease 4

experimental

Also known as: RNASE4, P34096

Ribonuclease 4 (RNASE4, P34096) is a member of the ribonuclease A superfamily that catalyzes the endonucleolytic cleavage of RNA, with a marked preference for uridine bases. This enzymatic activity distinguishes it from other RNase family members, which often favor cytidine or purine bases. The mechanism involves a conserved catalytic triad (His12, His119, Lys41) that facilitates transphosphorylation and hydrolysis of the phosphodiester bond, yielding 3'-phosphate-terminated products. RNASE4 is expressed in multiple tissues, including the liver, kidney, and pancreas, and is secreted into bodily fluids such as plasma and milk. Current experimental research on RNASE4 is limited, with 36 PubMed references indicating an early stage of investigation. Key findings suggest potential roles beyond RNA degradation, including antimicrobial activity, angiogenesis modulation, and neuroprotection. For instance, RNASE4 has been shown to inhibit bacterial growth and promote endothelial cell proliferation in vitro. Its expression is upregulated under hypoxic conditions, hinting at a possible function in stress responses. However, mechanistic details and in vivo validation remain sparse. Clinically, RNASE4 has not yet been translated into therapeutic applications. Its experimental status reflects a need for further studies to clarify its physiological significance and disease associations, such as potential links to cancer or inflammatory conditions. Given the limited evidence, no clinical recommendations can be made at this time. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG
Molecular weight
16840 g/mol
Research status
experimental
References
36
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, direct-protein-sequencing, disulfide-bond, endonuclease, hydrolase, nuclease, proteomics-identification, pyrrolidone-carboxylic-acid, reference-proteome

Mechanism of action

Cleaves preferentially after uridine bases (PubMed:3467790). Has antimicrobial activity against uropathogenic E.coli (UPEC) (PubMed:33818125). Probably contributes to urinary tract sterility (PubMed:33818125)

Research & studies

Subphenogroups of acute heart failure with preserved ejection fraction: comprehensive proteomics and pathway analysis
Heart (British Cardiac Society) · 2026 · PubMed
Ribonuclease 4 Functions in Nociceptor-Mediated Nerve Homeostasis
Nature communications · 2026 · PubMed
Ribonuclease 4 is a pancreatic endogenous β cell proliferation factor
Science bulletin · 2025 · PubMed
Ribonuclease 4 functions as an intestinal antimicrobial protein to maintain gut microbiota and metabolite homeostasis
Nature communications · 2024 · PubMed

RNASE4 is expressed in intestinal epithelial cells and detectable in human and mouse stool.; Rnase4 kills Parasutterella to modulate the intestinal microbiome.; Rnase4 enhances IDO1 expression and kynurenic/xanthurenic acid production, reducing colitis susceptibility.; Decreased RNASE4 levels in IBD patients correlate with increased stool Parasutterella.

Repurposing HDAC inhibitors to enhance ribonuclease 4 and 7 expression and reduce urinary tract infection
Proceedings of the National Academy of Sciences of the United States of America · 2023 · PubMed

HDAC inhibitors, including pan-HDAC and class I inhibitor MS-275, induce RNase 4 and 7 expression in human kidney and bladder cells.; MS-275 treatment in mice increased RNase 4 and 7 expression and protected against acute transurethral E. coli challenge.; MS-275 increased acetylated histone H3 binding to RNASE4 and RNASE7 promoters, and HDAC3 was identified as a primary regulator of these peptides.

Ribonuclease 4 is associated with aggressiveness and progression of prostate cancer
Communications biology · 2022 · PubMed
Expression and function of human ribonuclease 4 in the kidney and urinary tract
American journal of physiology. Renal physiology · 2021 · PubMed
Insights into the role of ribonuclease 4 polymorphisms in amyotrophic lateral sclerosis
Journal of biomolecular structure & dynamics · 2019 · PubMed

Frequently asked questions

What is Ribonuclease 4?

Ribonuclease 4 (RNASE4, P34096) is a member of the ribonuclease A superfamily that catalyzes the endonucleolytic cleavage of RNA, with a marked preference for uridine bases. This enzymatic activity distinguishes it from other RNase family members, which often favor cytidine or purine bases. The mechanism involves a con

How does Ribonuclease 4 work?

Cleaves preferentially after uridine bases (PubMed:3467790). Has antimicrobial activity against uropathogenic E.coli (UPEC) (PubMed:33818125). Probably contributes to urinary tract sterility (PubMed:33818125)

What is the research status of Ribonuclease 4?

Ribonuclease 4 is currently classified as experimental, with 36 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Ribonuclease 4?

Ribonuclease 4 has a molecular weight of approximately 16840 g/mol.

Related peptides

Build on Ribonuclease 4 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key