Reactive oxygen species modulator 1

experimental

Also known as: Epididymis tissue protein Li 175, Glyrichin, Mitochondrial targeting GxxxG motif protein, Protein MGR2 homolog, ROMO1, P60602

**Mechanism of Action** Reactive oxygen species modulator 1 (ROMO1) is a mitochondrial inner membrane protein that regulates cellular redox balance by promoting the generation of reactive oxygen species (ROS). It facilitates mitochondrial ROS production through interactions with respiratory chain complexes, particularly complex III, thereby modulating signaling pathways involved in cell proliferation. ROMO1 expression is tightly controlled; its upregulation increases ROS levels, which act as second messengers to activate proliferative cascades, while excessive ROS can trigger oxidative stress and apoptosis. **Key Research Findings** Preclinical studies demonstrate that ROMO1 is overexpressed in various cancers (e.g., lung, gastric, colorectal), correlating with tumor progression and poor prognosis. Silencing ROMO1 reduces ROS levels, suppresses cancer cell proliferation, and enhances sensitivity to chemotherapeutic agents. Conversely, ROMO1 knockout models show impaired cell cycle progression and increased apoptosis in rapidly dividing cells. Its role in normal physiology includes regulation of mitochondrial morphology and spermatogenesis, as evidenced by its initial identification in epididymal tissue. **Clinical Relevance** ROMO1 is an experimental target for cancer therapy, with ongoing research exploring inhibitors to selectively block ROS-mediated proliferation in malignant cells. Its potential as a biomarker for early cancer detection or treatment response is under investigation. However, no ROMO1-targeted therapies have advanced to clinical trials, and its dual role in promoting both proliferation and oxidative stress necessitates careful therapeutic modulation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Molecular weight
8183 g/mol
Research status
experimental
References
71
Tags
uniprot, alternative-splicing, antibiotic, antimicrobial, membrane, mitochondrion, mitochondrion-inner-membrane, proteomics-identification, reference-proteome, transmembrane, transmembrane-helix

Mechanism of action

Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation

Research & studies

The Inhibition of Reactive Oxygen Species Modulator 1 Attenuates Sevoflurane-Induced Neural Injury via Reducing Apoptosis and Oxidative Stress
Journal of molecular neuroscience : MN · 2024 · PubMed

Sevoflurane dose-dependently reduced cell viability and increased apoptosis in HT22 cells.; Sevoflurane elevated ROS, MDA, and LDH release while decreasing SOD activity.; ROMO1 knockdown with siROMO1 increased cell viability and reduced apoptosis and oxidative stress in sevoflurane-treated cells.; ROMO1 inhibition enhanced AKT phosphorylation, indicating involvement of the AKT pathway.

TRAF2 inhibits senescence in hepatocellular carcinoma cells via regulating the ROMO1/ NAD(+)/SIRT3/SOD2 axis
Free radical biology & medicine · 2024 · PubMed
Reactive Oxygen Species Modulator 1 Plays an Obligate Role in Cardiomyocyte Hypertrophy
Circulation research · 2024 · PubMed
Prognostic Impact of Reactive Oxygen Species Modulator 1 in Surgically Resected Epidermal Growth Factor Receptor-Mutant Lung Adenocarcinomas
Oncology · 2024 · PubMed
The Association of Oxidative Stress and Reactive Oxygen Species Modulator 1 (ROMO1) with Infertility: A Mini Review
Chonnam medical journal · 2022 · PubMed
Identification of reactive oxygen species modulator 1 (Romo 1) from black rockfish (Sebastes schlegelii) and deciphering its molecular characteristics, immune responses, oxidative stress modulation, and wound healing properties
Fish & shellfish immunology · 2022 · PubMed
The Association of COVID-19 and Reactive Oxygen Species Modulator 1 (ROMO1) with Oxidative Stress
Chonnam medical journal · 2022 · PubMed

COVID-19 promotes oxidative stress via TNF- and NF-κB pathways.; ROMO1 is a mitochondrial protein that critically regulates reactive oxygen species production.; ROMO1 dysfunction may enhance oxidative stress and cause lung tissue damage.; Understanding ROMO1's molecular role in COVID-19 may inform therapeutic strategies.

Overexpression of Reactive Oxygen Species Modulator 1 Predicts Unfavorable Clinical Outcome in EGFR-Mutant Lung Adenocarcinomas Treated With Targeted Therapy
Frontiers in oncology · 2021 · PubMed

Frequently asked questions

What is Reactive oxygen species modulator 1?

**Mechanism of Action** Reactive oxygen species modulator 1 (ROMO1) is a mitochondrial inner membrane protein that regulates cellular redox balance by promoting the generation of reactive oxygen species (ROS). It facilitates mitochondrial ROS production through interactions with respiratory chain complexes, particularl

How does Reactive oxygen species modulator 1 work?

Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation

What is the research status of Reactive oxygen species modulator 1?

Reactive oxygen species modulator 1 is currently classified as experimental, with 71 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Reactive oxygen species modulator 1?

Reactive oxygen species modulator 1 has a molecular weight of approximately 8183 g/mol.

Related peptides

Build on Reactive oxygen species modulator 1 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key