Putative beta-defensin 108A

experimental

Also known as: Defensin, beta 108A, Defensin, beta 108C, Putative beta-defensin 108B pseudogene 1/2, DEFB108A, DEFB108C, A8MXU0

Putative beta-defensin 108A (DEFB108A) is a member of the beta-defensin family of antimicrobial peptides, which are characterized by a conserved six-cysteine motif forming three disulfide bridges. Based on sequence homology, its proposed mechanism of action involves disruption of microbial cell membranes through electrostatic interactions with negatively charged bacterial phospholipids, leading to membrane permeabilization and cell death. However, no direct experimental validation of this activity has been published for DEFB108A specifically. Current research status remains strictly experimental, with no peer-reviewed studies indexed in PubMed as of the latest search. The gene is classified as a putative defensin, and its expression, regulation, and functional significance in vivo are uncharacterized. Some databases list DEFB108A as a potential pseudogene or non-functional variant, raising questions about whether it encodes a mature, active peptide. Given the absence of published data, clinical relevance cannot be established. No therapeutic applications, biomarker roles, or disease associations have been investigated. The peptide remains a theoretical entity within genomic annotations, requiring further molecular and functional studies to confirm its existence and activity. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRIAVLFFTIFFFMSQVLPAKGKFKEICERPNGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD
Molecular weight
8390 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Putative beta-defensin 108A?

Putative beta-defensin 108A (DEFB108A) is a member of the beta-defensin family of antimicrobial peptides, which are characterized by a conserved six-cysteine motif forming three disulfide bridges. Based on sequence homology, its proposed mechanism of action involves disruption of microbial cell membranes through electr

How does Putative beta-defensin 108A work?

Has antibacterial activity

What is the research status of Putative beta-defensin 108A?

Putative beta-defensin 108A is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Putative beta-defensin 108A?

Putative beta-defensin 108A has a molecular weight of approximately 8390 g/mol.

Related peptides

Build on Putative beta-defensin 108A data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key