Protein S100-A9

experimental

Also known as: Calgranulin-B, Calprotectin L1H subunit, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, S100 calcium-binding protein A9, S100A9, P06702

**Mechanism of Action** Protein S100-A9 (calgranulin-B) is a member of the S100 family of calcium-binding proteins, predominantly expressed in neutrophils, monocytes, and epithelial cells. It forms heterodimers with S100-A8 (calprotectin) and, upon calcium binding, undergoes conformational changes that enable interaction with toll-like receptor 4 (TLR4) and receptor for advanced glycation end-products (RAGE). This activates NF-κB and MAPK signaling pathways, promoting pro-inflammatory cytokine release (e.g., IL-6, TNF-α) and chemotaxis. S100-A9 also sequesters zinc and manganese, exerting antimicrobial effects by depriving pathogens of essential metals. **Key Research Findings** Elevated S100-A9 levels are consistently observed in inflammatory conditions such as rheumatoid arthritis, inflammatory bowel disease, and sepsis, where it correlates with disease activity. In cancer, S100-A9 promotes tumor progression via myeloid-derived suppressor cell (MDSC) recruitment and angiogenesis. Preclinical studies show that S100-A9 knockout mice exhibit reduced inflammation and tumor growth. Its role in sterile inflammation (e.g., atherosclerosis, obesity) is also under investigation, with 44 PubMed-indexed studies highlighting its potential as a biomarker and therapeutic target. **Clinical Relevance** S100-A9 is a validated biomarker for monitoring inflammatory disease activity (e.g., fecal calprotectin in IBD). Therapeutic strategies targeting S100-A9 include neutralizing antibodies (e.g., anti-S100A9 in phase II trials for psoriasis) and small-molecule inhibitors of TLR4/RAGE signaling. However, its dual role in host defense and chronic inflammation necessitates careful modulation. Further clinical validation is required for cancer and autoimmune indications. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Molecular weight
13242 g/mol
Research status
experimental
References
44
Tags
uniprot, 3d-structure, antimicrobial, antioxidant, apoptosis, autophagy, calcium, cell-membrane, chemotaxis, cytoplasm, cytoskeleton, direct-protein-sequencing

Mechanism of action

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, PubMed:8423249). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (PubMed:12626582, PubMed:15331440, PubMed:20103766). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (PubMed:16258195, PubMed:19122197, PubMed:8423249). The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed:15331440, PubMed:21325622). Also participates in regulatory T-cell differentiation together with CD69 (PubMed:26296369). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (PubMed:15642721, PubMed:22808130). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed:19534726, PubMed:8423249). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (PubMed:15598812, PubMed:21487906). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed:19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed:19402754, PubMed:22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (PubMed:19087201). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (PubMed:19935772). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (PubMed:22363402). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (PubMed:21912088, PubMed:22489132). Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread (PubMed:16258195). Has transnitrosylase activity; in oxidatively-modified low-densitity lipoprotein (LDL(ox))-induced S-nitrosylation of GAPDH on 'Cys-247' proposed to transfer the NO moiety from NOS2/iNOS to GAPDH via its own S-nitrosylated Cys-3 (PubMed:25417112). The iNOS-S100A8/A9 transnitrosylase complex is proposed to also direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (PubMed:25417112)

Research & studies

Proteomic characterization of Aspergillus fumigatus - host interactions using the ex-vivo pig lung (EVPL) model
Virulence · 2025 · PubMed

Fungal proteins for carbon metabolism (e.g., malate dehydrogenase, +8.2 fold) increased at 48 h, and amino acid metabolism (e.g., 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase, +5.04 fold) at 72 h.; Host innate immune proteins S100-A8 (+28.5 fold) and S100-A9 (+7.25 fold) increased at 24 h, while neutrophil degranulation proteins (e.g., elastase, -2.74 fold) decreased.; At 96 h, fibrotic markers fibrillin 1, collagen type IV alpha 1 and alpha 2 chains increased by +16.44, +15.42, and +11.95 fold, respectively.; The EVPL model retains resident immune cells and microbiome, validating its use for studying pathogen-host interactions in pulmonary tissue.

Gut-organ axis is more fragmented in ulcerative colitis: a metaproteomics study
Journal of applied microbiology · 2025 · PubMed

Microbial proteins for pentose phosphate pathway increased in UC, while energy metabolism, transporters, and protein folding decreased.; Iron metabolism and oxidative stress proteins suggest an oxidative gut environment favoring pathogenic microbes and intestinal damage.; Host proteins like neutrophil defensin 3 and lactotransferrin indicate inflammation and microbial infection in UC gut.; Altered short chain fatty acid concentrations and molecular docking of Omp-TLR4 suggest immune modulation and gut-organ axis fragmentation.

Dynamics of Cytokines and Chemokines During the Peripartum Period in People Living With Human Immunodeficiency Virus
American journal of reproductive immunology (New York, N.Y. : 1989) · 2025 · PubMed

Most chemokines decreased significantly from enrollment to postdelivery, followed by a postpartum rebound.; Myoglobin, SAA, and IL-6 increased from enrollment to postdelivery, then decreased postpartum.; S100A8/A9 and IGFBP4 consistently increased from enrollment through postpartum.; The postdelivery chemokine decline is a novel finding, possibly due to placental chemokine production or degradation during parturition.

Gut colonization with antibiotic-resistant Escherichia coli pathobionts leads to disease severity in ulcerative colitis
International journal of antimicrobial agents · 2024 · PubMed

UC patients had more antimicrobial resistance genes (829) than healthy controls (518).; Multi-drug resistant E. coli was more prevalent in UC (43.75%) than in controls (33.33%).; Upregulated antimicrobial proteins (lactotransferrin, azurocidin, cathepsin G, neutrophil elastase, neutrophil defensin 3) and inflammatory mediators (S100-A9, S100-A8) indicated infection in UC gut.; Rural populations showed higher AMR gene prevalence than urban populations in both UC and controls.

Exploring biomarkers for diagnosing and predicting organ dysfunction in patients with perioperative sepsis: a preliminary investigation
Perioperative medicine (London, England) · 2024 · PubMed
Differences in the Synovial Fluid Proteome of Septic and Aseptic Implant Failure
Antibiotics (Basel, Switzerland) · 2024 · PubMed
Morphological alterations in corneal nerves of patients with dry eye and associated biomarkers
Experimental eye research · 2023 · PubMed

DED patients had significantly higher corneal nerve branch density (CNBD) and total branch density (CTBD) than controls.; CNBD and CTBD showed significant negative correlations with tear breakup time (TBUT).; Six tear biomarkers (cystatin-S, immunoglobulin kappa constant, neutrophil gelatinase-associated lipocalin, profilin-1, protein S100-A8, protein S100-A9) positively correlated with CNBD and CTBD.; Morphological changes in corneal nerves are a hallmark of DED, supporting the use of confocal microscopy for diagnosis.

Comparative Proteomic Analysis of Milk-Derived Extracellular Vesicles from Dairy Cows with Clinical and Subclinical Mastitis
Animals : an open access journal from MDPI · 2023 · PubMed

Frequently asked questions

What is Protein S100-A9?

**Mechanism of Action** Protein S100-A9 (calgranulin-B) is a member of the S100 family of calcium-binding proteins, predominantly expressed in neutrophils, monocytes, and epithelial cells. It forms heterodimers with S100-A8 (calprotectin) and, upon calcium binding, undergoes conformational changes that enable interacti

How does Protein S100-A9 work?

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, PubMed:8423249). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation

What is the research status of Protein S100-A9?

Protein S100-A9 is currently classified as experimental, with 44 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Protein S100-A9?

Protein S100-A9 has a molecular weight of approximately 13242 g/mol.

Related peptides

Build on Protein S100-A9 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key