Protein S100-A8

experimental

Also known as: Calgranulin-A, Calprotectin L1L subunit, Cystic fibrosis antigen, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, S100 calcium-binding protein A8, Urinary stone protein band A, S100A8, P05109

**Mechanism of Action** Protein S100-A8 (calgranulin A) is a member of the S100 family of calcium-binding proteins, predominantly expressed in neutrophils, monocytes, and epithelial cells. It forms heterodimers with S100-A9 (calprotectin) and, upon calcium binding, undergoes conformational changes that enable interaction with toll-like receptor 4 (TLR4) and receptor for advanced glycation end-products (RAGE). These interactions activate NF-κB and MAPK signaling pathways, promoting pro-inflammatory cytokine release (e.g., IL-1β, TNF-α) and leukocyte recruitment. Additionally, S100-A8 sequesters zinc and manganese, exerting antimicrobial effects by depriving pathogens of essential trace metals. **Key Research Findings** Experimental studies demonstrate that S100-A8 is upregulated in acute and chronic inflammatory conditions, including rheumatoid arthritis, inflammatory bowel disease, and sepsis. Elevated serum levels correlate with disease activity and serve as a biomarker for inflammation. In murine models, S100-A8 deficiency reduces neutrophil infiltration and tissue damage in sterile inflammation, while its overexpression exacerbates autoimmune responses. Zinc-binding capacity also links S100-A8 to regulation of matrix metalloproteinases and wound healing. Current research explores its role in cancer-associated inflammation, where it may promote tumor progression via RAGE signaling. **Clinical Relevance** S100-A8 is an experimental target for anti-inflammatory therapies, with inhibitors of its interaction with TLR4/RAGE under preclinical investigation. Calprotectin (S100-A8/A9) is already used clinically as a fecal biomarker for gastrointestinal inflammation. However, direct therapeutic modulation of S100-A8 remains investigational, with no approved drugs targeting this protein. Its dual role in host defense and chronic inflammation necessitates careful context-dependent evaluation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Molecular weight
10835 g/mol
Research status
experimental
References
49
Tags
uniprot, 3d-structure, antimicrobial, apoptosis, autophagy, calcium, cell-membrane, chemotaxis, cytoplasm, cytoskeleton, direct-protein-sequencing, immunity

Mechanism of action

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Also participates in regulatory T-cell differentiation together with CD69 (PubMed:26296369). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. The iNOS-S100A8/A9 transnitrosylase complex directs selective inflammatory stimulus-dependent S-nitrosylation of GAPDH and probably multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity

Research & studies

Proteomic Analysis of Human Chylomicron Remnants Isolated by Apolipoprotein B-48 Immunoprecipitation
Journal of atherosclerosis and thrombosis · 2025 · PubMed

42 CM-Rs or VLDL-Rs-associated proteins were identified, including 11 potential new ones like platelet basic protein and platelet factor 4.; ApoA-I, apoA-IV, and clusterin (HDL-associated) were significantly more abundant in CM-Rs.; ApoC-I, which inhibits lipoprotein lipase and remnant catabolism, was also more abundant in CM-Rs.; Proteins involved in complement regulation and acute-phase response were found in both CM-Rs and VLDL-Rs.

Exploring novel protein biomarkers for early-stage diagnosis and prognosis of T-acute lymphoblastic leukemia (T-ALL)
Hematology, transfusion and cell therapy · 2024 · PubMed
Deficiency of S100A8/A9 attenuates pulmonary microvascular leakage in septic mice
Respiratory research · 2023 · PubMed
Proteomic profile of the acquired enamel pellicle of children with early childhood caries and caries-free children
European journal of oral sciences · 2023 · PubMed

241 proteins were identified in the acquired enamel pellicle of children.; Basic salivary proline-rich protein 1 and 2, Cystatin-B, and SA were found only in the caries-free group.; Caries-free group had higher levels of histatin-1, statherin, and other protective proteins.; ECC group showed higher levels of hemoglobin subunits, neutrophil defensin 3, and S100 proteins.

Saliva proteomic profile of early childhood caries and caries-free children
Acta odontologica Scandinavica · 2023 · PubMed
Acute response of biomarkers in plasma from capillary blood after a strenuous endurance exercise bout
European journal of applied physiology · 2023 · PubMed
Protein S100-A8: A potential metastasis-associated protein for breast cancer determined via iTRAQ quantitative proteomic and clinicopathological analysis
Oncology letters · 2018 · PubMed
Proteomic biomarkers for spontaneous preterm birth: a systematic review of the literature
Reproductive sciences (Thousand Oaks, Calif.) · 2014 · PubMed

64 dysregulated proteins were reported across 8 studies.; Only 5 proteins (14-3-3 protein sigma, annexin A5, protein S100-A8, protein S100-A12, and inter-α-trypsin inhibitor heavy chain H4) were reported in more than one study.; Results could not be combined due to heterogeneity in type of sample and analytical platform.; No specific proteomic biomarkers capable of accurately predicting PTB were identified.

Frequently asked questions

What is Protein S100-A8?

**Mechanism of Action** Protein S100-A8 (calgranulin A) is a member of the S100 family of calcium-binding proteins, predominantly expressed in neutrophils, monocytes, and epithelial cells. It forms heterodimers with S100-A9 (calprotectin) and, upon calcium binding, undergoes conformational changes that enable interacti

How does Protein S100-A8 work?

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and meta

What is the research status of Protein S100-A8?

Protein S100-A8 is currently classified as experimental, with 49 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Protein S100-A8?

Protein S100-A8 has a molecular weight of approximately 10835 g/mol.

Related peptides

Build on Protein S100-A8 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key