Protein S100-A12

experimental

Also known as: CGRP, Calcium-binding protein in amniotic fluid 1, Calgranulin-C, Extracellular newly identified RAGE-binding protein, Migration inhibitory factor-related protein 6, Neutrophil S100 protein, S100 calcium-binding protein A12, S100A12, P80511

**Mechanism of Action** Protein S100-A12 (Calgranulin-C) is a member of the S100 family of calcium-binding proteins, predominantly expressed in neutrophils and monocytes. Upon calcium binding, it undergoes conformational changes that enable interaction with the receptor for advanced glycation end products (RAGE) and Toll-like receptor 4 (TLR4). This triggers downstream pro-inflammatory signaling cascades, including NF-κB activation, leading to cytokine release (e.g., IL-6, TNF-α) and chemotaxis. Additionally, S100A12 chelates zinc and copper, contributing to antimicrobial activity and modulation of metal-dependent enzymatic processes. **Key Research Findings** Elevated S100A12 levels are documented in inflammatory conditions such as rheumatoid arthritis, inflammatory bowel disease, and sepsis, correlating with disease activity. Experimental studies demonstrate its role in amplifying neutrophil recruitment and oxidative burst. In murine models, S100A12 blockade reduces inflammation and tissue damage. Its extracellular functions as a damage-associated molecular pattern (DAMP) highlight its dual role in host defense and chronic inflammation. **Clinical Relevance** S100A12 is under investigation as a biomarker for inflammatory disease severity and therapeutic target. Serum levels may aid in distinguishing active inflammation from remission in conditions like Crohn’s disease. However, its clinical utility remains experimental, with no approved therapies targeting S100A12. Further research is needed to validate its diagnostic specificity and therapeutic potential. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Molecular weight
3795.4 g/mol
Molecular formula
C163H273N51O49S2
Research status
experimental
References
18
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, calcium, cell-membrane, copper, cytoplasm, cytoskeleton, direct-protein-sequencing, fungicide, immunity

Mechanism of action

S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its pro-inflammatory activity involves recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to receptor for advanced glycation endproducts (AGER). Binding to AGER activates the MAP-kinase and NF-kappa-B signaling pathways leading to production of pro-inflammatory cytokines and up-regulation of cell adhesion molecules ICAM1 and VCAM1. Acts as a monocyte and mast cell chemoattractant. Can stimulate mast cell degranulation and activation which generates chemokines, histamine and cytokines inducing further leukocyte recruitment to the sites of inflammation. Can inhibit the activity of matrix metalloproteinases; MMP2, MMP3 and MMP9 by chelating Zn(2+) from their active sites. Possesses filariacidal and filariastatic activity. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus

Research & studies

Sex-biased plasma inflammatory protein profile in obesity
Scientific reports · 2026 · PubMed
Causal network between periodontitis and systemic inflammation: Triangulating evidence from Mendelian randomization and sequencing datasets
Journal of periodontology · 2025 · PubMed

Three proteins (PD-L1, eotaxin, NRTN) were protective against periodontitis; three (S100A12, CXCL11, SULT1A1) were risk factors.; Sixteen immunocyte phenotypes were causally linked to periodontitis, and periodontitis increased circulating CXCL9/10/11 levels.; Periodontitis influenced regulatory T cells, T cell maturation stages, and conventional dendritic cells.; Single-cell and bulk-RNA sequencing and animal models validated the Mendelian randomization results.

Proteomic discovery analysis of quantitatively assessed emphysema in the general population. The MESA Lung Study
Respiratory research · 2025 · PubMed

35 plasma proteins replicated across general population and COPD cohorts, including novel associations (FAM177A1, syntenin-2, USP25, C20orf173) and known ones (sRAGE, S100-A12, HMGB1, ROBO2).; Enrichment analyses identified 40 GO biological processes (e.g., chemokine production, cell-cell adhesion) and two Reactome pathways (e.g., RAGE signaling).; Novel proteins improved predictive model performance (R² = 24.8%) and uniquely explained greater variance in percent emphysema.

Metabolic Biomarkers Mediate Allergic Conjunctivitis via Circulating Inflammatory Proteins: Evidence From a Mendelian Randomization Study
Translational vision science & technology · 2025 · PubMed
Inflammatory proteins and hidradenitis suppurativa: Insights from genetic correlation and Mendelian randomization
The Journal of dermatology · 2025 · PubMed
Causal association between circulating inflammatory markers and sciatica development: a Mendelian randomization study
Frontiers in neurology · 2024 · PubMed
Inflammatory proteins mediate male erectile dysfunction via plasma metabolites
Sexual medicine · 2024 · PubMed
Effects of Short- And Medium-Term Exposures to Lower Air Temperature on 71 Novel Biomarkers of Subclinical Inflammation: Results from the KORA F4 Study
Environmental science & technology · 2023 · PubMed

Frequently asked questions

What is Protein S100-A12?

**Mechanism of Action** Protein S100-A12 (Calgranulin-C) is a member of the S100 family of calcium-binding proteins, predominantly expressed in neutrophils and monocytes. Upon calcium binding, it undergoes conformational changes that enable interaction with the receptor for advanced glycation end products (RAGE) and To

How does Protein S100-A12 work?

S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its pro-inflammatory activity involves recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stim

What is the research status of Protein S100-A12?

Protein S100-A12 is currently classified as experimental, with 18 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Protein S100-A12?

Protein S100-A12 has a molecular weight of approximately 3795.4 g/mol (formula C163H273N51O49S2).

Related peptides

Build on Protein S100-A12 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key