Protein GPR15LG

experimental

Also known as: Antimicrobial peptide with 57 amino acid residues, Colon-derived SUSD2 binding factor, Protein GPR15 ligand, Protein GPR15L, Secreted protein C10orf99, GPR15LG, Q6UWK7

**Mechanism of Action** GPR15LG (also known as C10orf99) is a 57-amino-acid, highly cationic secreted protein that functions as a ligand for the G protein-coupled receptor GPR15. Its cationic nature facilitates electrostatic interactions with negatively charged cell membranes, contributing to antimicrobial activity. Additionally, GPR15LG binds to the sushi domain-containing protein SUSD2 on colonic epithelial cells, modulating immune cell recruitment and epithelial barrier function. The protein exhibits pleiotropic effects, including chemotactic signaling and potential regulation of mucosal homeostasis. **Key Research Findings** As an experimental peptide with no indexed PubMed references, current knowledge is derived from preliminary studies and sequence-based predictions. GPR15LG is predominantly expressed in the colon and is implicated in host defense against microbial pathogens due to its antimicrobial properties. Its interaction with GPR15 suggests a role in immune cell trafficking, particularly in gastrointestinal tissues. The SUSD2 binding activity further indicates involvement in cell adhesion and tissue-specific signaling, though functional validation remains limited. **Clinical Relevance** Given its experimental status, GPR15LG has no established clinical applications. Potential therapeutic avenues include antimicrobial therapy for gastrointestinal infections or modulation of inflammatory bowel disease via GPR15/SUSD2 pathways. However, absence of peer-reviewed human studies precludes any translational conclusions. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV
Molecular weight
6515 g/mol
Molecular formula
C286H469N97O70S4
Research status
experimental
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, chemotaxis, cytokine, direct-protein-sequencing, disulfide-bond, glycoprotein, proteomics-identification, reference-proteome, secreted

Mechanism of action

Highly cationic protein that has multiple functions. Acts as a chemotactic factor that mediates lymphocytes recruitment to epithelia through binding and activation of the G protein-coupled receptor GPR15 (PubMed:28900043, PubMed:28936214). May be a tumor suppressor; together with SUSD2 has a growth inhibitory effect on colon cancer cells which includes G1 cell cycle arrest (PubMed:25351403). May regulate keratinocyte proliferation (PubMed:29872130). In addition, through activation of Mas-related G protein-coupled receptors (MRGPRs) contributes to pruritogenesis by activating itch-selective sensory neurons and mast cells degranulation (PubMed:35704588)

Frequently asked questions

What is Protein GPR15LG?

**Mechanism of Action** GPR15LG (also known as C10orf99) is a 57-amino-acid, highly cationic secreted protein that functions as a ligand for the G protein-coupled receptor GPR15. Its cationic nature facilitates electrostatic interactions with negatively charged cell membranes, contributing to antimicrobial activity. Ad

How does Protein GPR15LG work?

Highly cationic protein that has multiple functions. Acts as a chemotactic factor that mediates lymphocytes recruitment to epithelia through binding and activation of the G protein-coupled receptor GPR15 (PubMed:28900043, PubMed:28936214). May be a tumor suppressor; together with SUSD2 has a growth inhibitory effect on colon cancer cells which includes G1 cell cycle arrest (PubMed:25351403). May r

What is the research status of Protein GPR15LG?

Protein GPR15LG is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Protein GPR15LG?

Protein GPR15LG has a molecular weight of approximately 6515 g/mol (formula C286H469N97O70S4).

Related peptides

Build on Protein GPR15LG data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key