Platelet basic protein
experimentalAlso known as: C-X-C motif chemokine 7, Leukocyte-derived growth factor, Macrophage-derived growth factor, Small-inducible cytokine B7, PPBP, P02775
Platelet basic protein (PBP), also known as C-X-C motif chemokine 7 (CXCL7), is a chemokine stored in platelet alpha-granules and released upon platelet activation. Its mechanism of action involves proteolytic processing to yield several bioactive forms, including connective tissue-activating peptide III (CTAP-III) and neutrophil-activating peptide 2 (NAP-2). The low-affinity platelet factor 4 (LA-PF4) variant of PBP stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycans, indicating a role in cellular proliferation and extracellular matrix remodeling. Key research findings indicate that PBP and its derivatives promote fibroblast and smooth muscle cell proliferation, chemotaxis, and activation of neutrophils. Studies have implicated PBP in wound healing, angiogenesis, and inflammatory responses. Elevated levels have been observed in conditions such as atherosclerosis, rheumatoid arthritis, and certain cancers, suggesting involvement in chronic inflammation and tissue repair processes. However, its precise physiological and pathological roles remain under investigation. Clinically, PBP is considered an experimental biomarker and therapeutic target. Its potential applications include monitoring platelet activation in cardiovascular disease, assessing inflammatory states, and developing interventions for fibrotic or proliferative disorders. Further research is needed to validate its utility in diagnostics or therapeutics. For research purposes only — not medical advice.
Key data
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESADC22H25N3OMechanism of action
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation
Research & studies
CD8+ TSCM cells are increased in patients with major depressive disorder and stress-susceptible mice, correlating with depression severity.; Adoptive transfer of stress-derived CD8+ TSCM cells induces depressive-like behavior and neuroinflammation in recipients.; CD8+ TSCM cells migrate to the intestine via PPBP-CXCR2 interaction, not the brain.; These cells decrease tyrosine-metabolizing gut bacteria, reducing homovanillic acid production and promoting neuroinflammation.
Frequently asked questions
What is Platelet basic protein?
Platelet basic protein (PBP), also known as C-X-C motif chemokine 7 (CXCL7), is a chemokine stored in platelet alpha-granules and released upon platelet activation. Its mechanism of action involves proteolytic processing to yield several bioactive forms, including connective tissue-activating peptide III (CTAP-III) and
How does Platelet basic protein work?
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoa
What is the research status of Platelet basic protein?
Platelet basic protein is currently classified as experimental, with 121 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Platelet basic protein?
Platelet basic protein has a molecular weight of approximately 347.5 g/mol (formula C22H25N3O).
Related peptides
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
Human cathelicidin antimicrobial peptide with broad-spectrum antibacterial, immunomodulatory, and wound-healing activity.
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization i…
Antimicrobial protein that kills intracellular pathogens.
28-aa thymic peptide that enhances T-cell maturation and TLR signaling; approved in many countries for hepatitis and as an immune adjuvant.
Zinc-dependent thymic nonapeptide that regulates T-cell differentiation and has analgesic and anti-inflammatory effects.
Build on Platelet basic protein data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key