Platelet basic protein

experimental

Also known as: C-X-C motif chemokine 7, Leukocyte-derived growth factor, Macrophage-derived growth factor, Small-inducible cytokine B7, PPBP, P02775

Platelet basic protein (PBP), also known as C-X-C motif chemokine 7 (CXCL7), is a chemokine stored in platelet alpha-granules and released upon platelet activation. Its mechanism of action involves proteolytic processing to yield several bioactive forms, including connective tissue-activating peptide III (CTAP-III) and neutrophil-activating peptide 2 (NAP-2). The low-affinity platelet factor 4 (LA-PF4) variant of PBP stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycans, indicating a role in cellular proliferation and extracellular matrix remodeling. Key research findings indicate that PBP and its derivatives promote fibroblast and smooth muscle cell proliferation, chemotaxis, and activation of neutrophils. Studies have implicated PBP in wound healing, angiogenesis, and inflammatory responses. Elevated levels have been observed in conditions such as atherosclerosis, rheumatoid arthritis, and certain cancers, suggesting involvement in chronic inflammation and tissue repair processes. However, its precise physiological and pathological roles remain under investigation. Clinically, PBP is considered an experimental biomarker and therapeutic target. Its potential applications include monitoring platelet activation in cardiovascular disease, assessing inflammatory states, and developing interventions for fibrotic or proliferative disorders. Further research is needed to validate its utility in diagnostics or therapeutics. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Molecular weight
347.5 g/mol
Molecular formula
C22H25N3O
CAS number
53-89-4
Research status
experimental
References
121
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, chemotaxis, cleavage-on-pair-of-basic-residues, cytokine, direct-protein-sequencing, disulfide-bond, growth-factor, mitogen, proteomics-identification

Mechanism of action

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation

Research & studies

Migration of CD8 + TSCM cells into intestine via PPBP-CXCR2 axis increases host stress susceptibility by inhibiting gut microbiome-derived homovanillic acid
Nature communications · 2025 · PubMed

CD8+ TSCM cells are increased in patients with major depressive disorder and stress-susceptible mice, correlating with depression severity.; Adoptive transfer of stress-derived CD8+ TSCM cells induces depressive-like behavior and neuroinflammation in recipients.; CD8+ TSCM cells migrate to the intestine via PPBP-CXCR2 interaction, not the brain.; These cells decrease tyrosine-metabolizing gut bacteria, reducing homovanillic acid production and promoting neuroinflammation.

Impact of platelet transfusions on plasma proteomes in controlled endotoxemia and in hemato-oncological patients
Transfusion · 2025 · PubMed
System pharmacology reveals the mechanism of action of Shengbai Oral Liquid alleviates chemotherapy-induced leukopenia by interfering the pro-platelet basic protein: Integrated network study of multi-omics
Journal of ethnopharmacology · 2025 · PubMed
The expression levels of chemotaxis-related molecules CXC chemokine receptor 1, interleukin-8, and pro-platelet basic protein in gingival tissues
Journal of dental sciences · 2024 · PubMed
Serum amyloid P component and pro-platelet basic protein in extracellular vesicles or serum are novel markers of liver fibrosis in chronic hepatitis C patients
PloS one · 2022 · PubMed
Role of the platelet chemokine platelet factor 4 (PF4) in hemostasis and thrombosis
Thrombosis research · 2010 · PubMed
Differential chemotactic potential of mouse platelet basic protein for thymocyte subsets
Cellular and molecular life sciences : CMLS · 2004 · PubMed
Constitutive and regulated expression of platelet basic protein in human monocytes
Journal of leukocyte biology · 2004 · PubMed

Frequently asked questions

What is Platelet basic protein?

Platelet basic protein (PBP), also known as C-X-C motif chemokine 7 (CXCL7), is a chemokine stored in platelet alpha-granules and released upon platelet activation. Its mechanism of action involves proteolytic processing to yield several bioactive forms, including connective tissue-activating peptide III (CTAP-III) and

How does Platelet basic protein work?

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoa

What is the research status of Platelet basic protein?

Platelet basic protein is currently classified as experimental, with 121 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Platelet basic protein?

Platelet basic protein has a molecular weight of approximately 347.5 g/mol (formula C22H25N3O).

Related peptides

Build on Platelet basic protein data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key