Phospholipase A2, membrane associated
experimentalAlso known as: GIIC sPLA2, Group IIA phospholipase A2, Non-pancreatic secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 2A, PLA2G2A, P14555
Phospholipase A2, membrane-associated (PLA2G2A), also known as Group IIA secretory phospholipase A2 (GIIC sPLA2), is a calcium-dependent enzyme that catalyzes the hydrolysis of the sn-2 ester bond of membrane glycerophospholipids, releasing free fatty acids and lysophospholipids. Its mechanism of action is primarily extracellular, targeting bacterial membranes and host cell phospholipids. The enzyme exhibits potent bactericidal activity by disrupting bacterial cell wall integrity, particularly against Gram-positive bacteria. Additionally, PLA2G2A generates lipid mediators such as arachidonic acid, which serve as precursors for pro-inflammatory eicosanoids, thereby amplifying inflammatory signaling cascades. Its activity is tightly regulated by calcium ion concentration and post-translational modifications. Key research findings indicate that PLA2G2A plays a dual role in host defense and inflammatory pathology. In antimicrobial defense, it directly kills bacteria and synergizes with other innate immune components. In inflammation, elevated PLA2G2A levels are associated with conditions such as rheumatoid arthritis, sepsis, and atherosclerosis, where it contributes to tissue damage and chronic inflammation. Experimental studies also suggest involvement in tissue regeneration, though mechanisms remain under investigation. The enzyme's expression is induced by pro-inflammatory cytokines (e.g., IL-1β, TNF-α) and is elevated in various inflammatory diseases, making it a potential biomarker. Clinically, PLA2G2A is considered an experimental target for therapeutic intervention in inflammatory and infectious diseases. Inhibitors of sPLA2 enzymes have been explored in preclinical models to reduce inflammation and tissue injury, though none have advanced to approved clinical use. Its role in antimicrobial defense also raises considerations for selective targeting to avoid compromising host immunity. Further research is needed to clarify its context-dependent functions and therapeutic potential. For research purposes only — not medical advice.
Key data
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRCC15H20ClNO3Mechanism of action
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids with implications in host antimicrobial defense, inflammatory response and tissue regeneration (PubMed:10455175, PubMed:10681567, PubMed:2925633). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines (PubMed:10455175, PubMed:10681567). Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane (PubMed:10358193, PubMed:11694541). Upon sterile inflammation, targets membrane phospholipids of extracellular mitochondria released from activated platelets, generating free unsaturated fatty acids such as arachidonate that is used by neighboring leukocytes to synthesize inflammatory eicosanoids such as leukotrienes. Simultaneously, by compromising mitochondrial membrane integrity, promotes the release in circulation of potent damage-associated molecular pattern molecules that activate the innate immune response (PubMed:25082876). Plays a stem cell regulator role in the intestinal crypt. Within intracellular compartment mediates Paneth cell differentiation and its stem cell supporting functions by inhibiting Wnt signaling pathway in intestinal stem cell (ICS). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates Wnt signaling pathway in ICS cells and tissue regeneration (By similarity). May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism and inflammation. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines (PubMed:14998370). Independent of its catalytic activity, acts as a ligand for integrins (PubMed:18635536, PubMed:25398877). Binds to and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 (PubMed:18635536, PubMed:25398877). Binds to a site (site 2) which is distinct from the classical ligand-binding site (site 1) and induces integrin conformational changes and enhanced ligand binding to site 1 (PubMed:25398877). Induces cell proliferation in an integrin-dependent manner (PubMed:18635536)
Research & studies
Multivariate modeling identified 16 functional protein groups with sex-specific associations in carotid atheroma.; Ten proteins showed region-specific sex differences, including afamin, antithrombin-III, and coagulation factor XII (higher in women's plaque).; Inflammatory proteins lysozyme C and phospholipase A2 membrane-associated were significantly increased in men's plaque region.; This pilot study provides the first multivariate proteomic analysis of sexual dimorphism in human atherosclerotic tissue.
Serum M-PLA2 levels did not differ significantly between smokers and non-smokers.; BALF M-PLA2 levels were significantly higher in smokers, whether expressed per volume or per protein content.; Northern blot analysis showed greater M-PLA2 mRNA levels in BALF cells from smokers than non-smokers.; Increased M-PLA2 in the lower respiratory tract may contribute to smoking-related pulmonary disease.
Frequently asked questions
What is Phospholipase A2, membrane associated?
Phospholipase A2, membrane-associated (PLA2G2A), also known as Group IIA secretory phospholipase A2 (GIIC sPLA2), is a calcium-dependent enzyme that catalyzes the hydrolysis of the sn-2 ester bond of membrane glycerophospholipids, releasing free fatty acids and lysophospholipids. Its mechanism of action is primarily ex
How does Phospholipase A2, membrane associated work?
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids with implications in host antimicrobial defense, inflammatory response and tissue regeneration (PubMed:10455175, PubMed:10681567, PubMed:2925633). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity) with preference for phosphatidyletha
What is the research status of Phospholipase A2, membrane associated?
Phospholipase A2, membrane associated is currently classified as experimental, with 2 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Phospholipase A2, membrane associated?
Phospholipase A2, membrane associated has a molecular weight of approximately 297.78 g/mol (formula C15H20ClNO3).
Related peptides
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
Human cathelicidin antimicrobial peptide with broad-spectrum antibacterial, immunomodulatory, and wound-healing activity.
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization i…
Antimicrobial protein that kills intracellular pathogens.
28-aa thymic peptide that enhances T-cell maturation and TLR signaling; approved in many countries for hepatitis and as an immune adjuvant.
Zinc-dependent thymic nonapeptide that regulates T-cell differentiation and has analgesic and anti-inflammatory effects.
Build on Phospholipase A2, membrane associated data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key