Neutrophil defensin 3

experimental

Also known as: Defensin, alpha 3, HNP-3, DEFA3, P59666

**Mechanism of Action** Neutrophil defensin 3 (HNP-3) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils. It exerts broad-spectrum antimicrobial activity by disrupting microbial membranes through electrostatic interactions with negatively charged phospholipids, leading to pore formation and cell lysis. Additionally, HNP-3 modulates host immune responses by promoting chemotaxis, activating complement, and enhancing phagocytosis, while also exhibiting antiviral effects via direct binding to viral envelopes. **Key Research Findings** Preclinical studies demonstrate HNP-3’s efficacy against Gram-positive and Gram-negative bacteria (e.g., *Staphylococcus aureus*, *Escherichia coli*), fungi (e.g., *Candida albicans*), and enveloped viruses (e.g., HIV-1, herpes simplex virus). Its activity is salt-sensitive and concentration-dependent, with optimal function at physiological pH. Research also highlights its role in wound healing and inflammation regulation, though cytotoxicity at high doses limits therapeutic application. **Clinical Relevance** HNP-3 remains in the experimental stage, with no approved clinical indications. Its potential as an adjunctive therapy for antibiotic-resistant infections or as an immunomodulatory agent is under investigation, but challenges include stability, delivery, and off-target effects. Current evidence is limited to *in vitro* and animal models. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight
10245 g/mol
Research status
experimental
References
13
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, antiviral-defense, defensin, direct-protein-sequencing, disulfide-bond, fungicide, proteomics-identification, reference-proteome, secreted

Mechanism of action

Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses (PubMed:15616305, PubMed:15772169, PubMed:17142766). Possesses the ability to neutralize bacterial toxins such as B.anthracis lethal factor, Clostridium difficile cytotoxin B as well as leukocidin produced by Staphylococcus aureus (PubMed:15772169, PubMed:18435932, PubMed:25963798). Also blocks herpes simplex virus infection by interacting with envelope glycoprotein B and thus preventing its binding to heparan sulfate, the receptor for attachment (PubMed:17142766)

Research & studies

Salivary Proteomic Signatures Reveal Novel Mechanistic Insights into Moderate Dental Fluorosis Pathogenesis and Oral Homeostasis Disruption
Computational and structural biotechnology journal · 2026 · PubMed
Clinical Characteristics and Comparative Proteomics Analysis of COVID-19-Related Atrioventricular Block
Reviews in cardiovascular medicine · 2024 · PubMed
Differential Gene Expression Among Patients With Heart Failure Experiencing Pain
Nursing research · 2023 · PubMed

334 genes (279 upregulated, 55 downregulated) were differentially expressed between heart failure patients with and without pain.; Differentially expressed genes were largely aligned with neutrophil degranulation pathways.; Three genes (MMP8, PCSK9, DEFA3) were upregulated in patients with pain in both primary and validation samples.; All seven genes of interest are involved in immune, inflammatory, and atherosclerotic processes.

Myopia Control Efficacy and Long-Term Safety of a Novel Orthokeratology Lens (MESOK Study)-A Randomized Controlled Clinical Trial Combining Clinical and Tear Proteomics Data
Journal of clinical medicine · 2023 · PubMed
Proteomic analysis of infected root canals with apical periodontitis in patients with type 2 diabetes mellitus: A cross-sectional study
International endodontic journal · 2022 · PubMed
Sputum Protein Biomarkers in Airway Diseases: A Pilot Study
International journal of chronic obstructive pulmonary disease · 2021 · PubMed
High Migration and Invasion Ability of PGCCs and Their Daughter Cells Associated With the Nuclear Localization of S100A10 Modified by SUMOylation
Frontiers in cell and developmental biology · 2021 · PubMed
Mass Spectrometry-Based Identification of Urinary Antimicrobial Peptides in Dairy Cows
Protein and peptide letters · 2020 · PubMed

Frequently asked questions

What is Neutrophil defensin 3?

**Mechanism of Action** Neutrophil defensin 3 (HNP-3) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils. It exerts broad-spectrum antimicrobial activity by disrupting microbial membranes through electrostatic interactions with negatively charged phospholipids, leading to pore formation a

How does Neutrophil defensin 3 work?

Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses (PubMed:15616305, PubMed:15772169, PubMed:17142766). Possesses the ability to neutralize bacterial toxins such as B.anthracis lethal factor, Clostridium difficile cytotoxin B as well as leukocidin produced by Staphylococcus aureus

What is the research status of Neutrophil defensin 3?

Neutrophil defensin 3 is currently classified as experimental, with 13 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Neutrophil defensin 3?

Neutrophil defensin 3 has a molecular weight of approximately 10245 g/mol.

Related peptides

Build on Neutrophil defensin 3 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key