Neutrophil defensin 1
experimentalAlso known as: Defensin, alpha 1, HNP-1, DEFA1, DEFA1B, P59665
**Mechanism of Action** Neutrophil defensin 1 (HNP-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils. Its primary mechanism involves disruption of microbial membranes via electrostatic interactions with negatively charged phospholipids, leading to pore formation and cell lysis. Additionally, HNP-1 modulates innate immunity by promoting chemotaxis of immune cells, inducing cytokine release, and enhancing antigen presentation through dendritic cell maturation. It also exhibits antiviral activity by interfering with viral envelope integrity and inhibiting viral replication. **Key Research Findings** Preclinical studies demonstrate broad-spectrum activity against Gram-positive and Gram-negative bacteria (e.g., *Staphylococcus aureus*, *Escherichia coli*), fungi (*Candida albicans*), and enveloped viruses (e.g., HIV-1, herpes simplex virus). HNP-1 has been shown to synergize with conventional antibiotics and reduce biofilm formation. In animal models, exogenous HNP-1 improves survival in sepsis and pulmonary infections. However, its therapeutic potential is limited by cytotoxicity at high concentrations and susceptibility to proteolytic degradation. **Clinical Relevance** HNP-1 remains in the experimental stage, with no approved clinical applications. Its role as a biomarker for infectious and inflammatory diseases (e.g., sepsis, cystic fibrosis) is under investigation. Challenges include optimizing delivery systems and minimizing off-target effects. Current research focuses on synthetic analogs with enhanced stability and selectivity. For research purposes only — not medical advice.
Key data
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCCC150H222N44O38S6Mechanism of action
Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses or by promoting the activation and maturation of some APCs (PubMed:15616305, PubMed:17142766, PubMed:20220136, PubMed:24236072). Interacts with the essential precursor of cell wall synthesis lipid II to inhibit bacterial cell wall synthesis (PubMed:20214904). Inhibits adenovirus infection via inhibition of viral disassembly at the vertex region, thereby restricting the release of internal capsid protein pVI, which is required for endosomal membrane penetration during cell entry (PubMed:18191790). In addition, interaction with adenovirus capsid leads to the redirection of viral particles to TLR4 thereby promoting a NLRP3-mediated inflammasome response and interleukin 1-beta (IL-1beta) release (PubMed:35080426). Induces the production of proinflammatory cytokines including type I interferon (IFN) in plasmacytoid dendritic cells (pDCs) by triggering the degradation of NFKBIA and nuclear translocation of IRF1, both of which are required for activation of pDCs (PubMed:27031443)
Research & studies
HNP-1 directly binds to the transmembrane domain of SaeS.; HNP-1 binding significantly increases SaeS kinase activity.; Activation of the SaeRS system enhances virulence and immune evasion.; Host-derived defensins may be exploited by S. aureus to boost antimicrobial peptide resistance.
2Abz14S29 and 2Abz23S29 were classified as stable peptides, while HNP-1 and HNP1 C18A were unstable.; Molecular docking showed similar interaction patterns of all peptides with lipid II.; Binding affinity constant (Kd) of HNP-1 and 2Abz23S29 with lipid II was 10 times stronger than 2Abz14S29 and HNP1 C18A.; Chemical modifications improved physicochemical properties while retaining antimicrobial patterns similar to HNP-1.
Five candidate proteins (S100-A8, S100-A9, S100-A12, neutrophil defensin 1, alpha-1-acid glycoprotein 1) were identified for the KD prediction model.; The protein-based prediction model had an auROC of 0.92 (95% CI: 0.84, 0.98).; Conventional laboratory items (CRP, GPT, WBC, platelet, segment, hemoglobin) formed a model with auROC 0.88 (95% CI: 0.80, 0.96).; The protein model is a good diagnostic tool, and the conventional lab model is an acceptable alternative.
Frequently asked questions
What is Neutrophil defensin 1?
**Mechanism of Action** Neutrophil defensin 1 (HNP-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils. Its primary mechanism involves disruption of microbial membranes via electrostatic interactions with negatively charged phospholipids, leading to pore formation and cell lysis. Additi
How does Neutrophil defensin 1 work?
Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses or by promoting the activation and maturation of some APCs (PubMed:15616305, PubMed:17142766, PubMed:20220136, PubMed:24236072). Interacts with the essential precursor of cell wall synthesis lipid II to inhibit bacterial cell wall
What is the research status of Neutrophil defensin 1?
Neutrophil defensin 1 is currently classified as experimental, with 48 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Neutrophil defensin 1?
Neutrophil defensin 1 has a molecular weight of approximately 3442 g/mol (formula C150H222N44O38S6).
Related peptides
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
Human cathelicidin antimicrobial peptide with broad-spectrum antibacterial, immunomodulatory, and wound-healing activity.
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization i…
Antimicrobial protein that kills intracellular pathogens.
28-aa thymic peptide that enhances T-cell maturation and TLR signaling; approved in many countries for hepatitis and as an immune adjuvant.
Zinc-dependent thymic nonapeptide that regulates T-cell differentiation and has analgesic and anti-inflammatory effects.
Build on Neutrophil defensin 1 data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key