Neutrophil defensin 1

experimental

Also known as: Defensin, alpha 1, HNP-1, DEFA1, DEFA1B, P59665

**Mechanism of Action** Neutrophil defensin 1 (HNP-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils. Its primary mechanism involves disruption of microbial membranes via electrostatic interactions with negatively charged phospholipids, leading to pore formation and cell lysis. Additionally, HNP-1 modulates innate immunity by promoting chemotaxis of immune cells, inducing cytokine release, and enhancing antigen presentation through dendritic cell maturation. It also exhibits antiviral activity by interfering with viral envelope integrity and inhibiting viral replication. **Key Research Findings** Preclinical studies demonstrate broad-spectrum activity against Gram-positive and Gram-negative bacteria (e.g., *Staphylococcus aureus*, *Escherichia coli*), fungi (*Candida albicans*), and enveloped viruses (e.g., HIV-1, herpes simplex virus). HNP-1 has been shown to synergize with conventional antibiotics and reduce biofilm formation. In animal models, exogenous HNP-1 improves survival in sepsis and pulmonary infections. However, its therapeutic potential is limited by cytotoxicity at high concentrations and susceptibility to proteolytic degradation. **Clinical Relevance** HNP-1 remains in the experimental stage, with no approved clinical applications. Its role as a biomarker for infectious and inflammatory diseases (e.g., sepsis, cystic fibrosis) is under investigation. Challenges include optimizing delivery systems and minimizing off-target effects. Current research focuses on synthetic analogs with enhanced stability and selectivity. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight
3442 g/mol
Molecular formula
C150H222N44O38S6
CAS number
148093-65-6
Research status
experimental
References
48
Tags
uniprot, 3d-structure, adp-ribosylation, antibiotic, antimicrobial, antiviral-defense, defensin, direct-protein-sequencing, disulfide-bond, fungicide, host-virus-interaction, phosphoprotein

Mechanism of action

Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses or by promoting the activation and maturation of some APCs (PubMed:15616305, PubMed:17142766, PubMed:20220136, PubMed:24236072). Interacts with the essential precursor of cell wall synthesis lipid II to inhibit bacterial cell wall synthesis (PubMed:20214904). Inhibits adenovirus infection via inhibition of viral disassembly at the vertex region, thereby restricting the release of internal capsid protein pVI, which is required for endosomal membrane penetration during cell entry (PubMed:18191790). In addition, interaction with adenovirus capsid leads to the redirection of viral particles to TLR4 thereby promoting a NLRP3-mediated inflammasome response and interleukin 1-beta (IL-1beta) release (PubMed:35080426). Induces the production of proinflammatory cytokines including type I interferon (IFN) in plasmacytoid dendritic cells (pDCs) by triggering the degradation of NFKBIA and nuclear translocation of IRF1, both of which are required for activation of pDCs (PubMed:27031443)

Research & studies

Characterisation of the periodontal proteome in gingival crevicular fluid and saliva using SWATH-MS
Frontiers in cellular and infection microbiology · 2025 · PubMed
Human neutrophil defensin-1 binding increases histidine kinase activity of SaeS in Staphylococcus aureus
Biochemistry and biophysics reports · 2025 · PubMed

HNP-1 directly binds to the transmembrane domain of SaeS.; HNP-1 binding significantly increases SaeS kinase activity.; Activation of the SaeRS system enhances virulence and immune evasion.; Host-derived defensins may be exploited by S. aureus to boost antimicrobial peptide resistance.

Selected Markers of Inflammation in the Saliva of Children Infected with Helicobacter pylori
International journal of molecular sciences · 2024 · PubMed
Acquired pellicle and biofilm engineering with CaneCPI-5: Insights from proteomic and microbiomics analysis
Archives of oral biology · 2024 · PubMed
Salivary immunity of elite collegiate American football players infected with SARS-CoV-2 normalizes following isolation
Scientific reports · 2022 · PubMed
Computational evaluation of modified peptides from human neutrophil peptide 1 (HNP-1)
Journal of biomolecular structure & dynamics · 2022 · PubMed

2Abz14S29 and 2Abz23S29 were classified as stable peptides, while HNP-1 and HNP1 C18A were unstable.; Molecular docking showed similar interaction patterns of all peptides with lipid II.; Binding affinity constant (Kd) of HNP-1 and 2Abz23S29 with lipid II was 10 times stronger than 2Abz14S29 and HNP1 C18A.; Chemical modifications improved physicochemical properties while retaining antimicrobial patterns similar to HNP-1.

Prediction Model for Diagnosis of Kawasaki Disease Using iTRAQ-Based Analysis
Children (Basel, Switzerland) · 2021 · PubMed

Five candidate proteins (S100-A8, S100-A9, S100-A12, neutrophil defensin 1, alpha-1-acid glycoprotein 1) were identified for the KD prediction model.; The protein-based prediction model had an auROC of 0.92 (95% CI: 0.84, 0.98).; Conventional laboratory items (CRP, GPT, WBC, platelet, segment, hemoglobin) formed a model with auROC 0.88 (95% CI: 0.80, 0.96).; The protein model is a good diagnostic tool, and the conventional lab model is an acceptable alternative.

Significant salivary changes in relation to oral mucositis following autologous hematopoietic stem cell transplantation
Bone marrow transplantation · 2021 · PubMed

Frequently asked questions

What is Neutrophil defensin 1?

**Mechanism of Action** Neutrophil defensin 1 (HNP-1) is a cationic antimicrobial peptide stored in azurophilic granules of neutrophils. Its primary mechanism involves disruption of microbial membranes via electrostatic interactions with negatively charged phospholipids, leading to pore formation and cell lysis. Additi

How does Neutrophil defensin 1 work?

Effector molecule of the innate immune system that acts via antibiotic-like properties against a broad array of infectious agents including bacteria, fungi, and viruses or by promoting the activation and maturation of some APCs (PubMed:15616305, PubMed:17142766, PubMed:20220136, PubMed:24236072). Interacts with the essential precursor of cell wall synthesis lipid II to inhibit bacterial cell wall

What is the research status of Neutrophil defensin 1?

Neutrophil defensin 1 is currently classified as experimental, with 48 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Neutrophil defensin 1?

Neutrophil defensin 1 has a molecular weight of approximately 3442 g/mol (formula C150H222N44O38S6).

Related peptides

Build on Neutrophil defensin 1 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key