Lysozyme-like protein 6

experimental

Also known as: LYZL6, O75951

Lysozyme-like protein 6 (LYZL6, UniProt O75951) is an experimental protein belonging to the c-type lysozyme/alpha-lactalbumin family. Its proposed mechanism of action involves participation in sperm-egg plasma membrane adhesion and fusion during fertilization, potentially through binding to carbohydrate moieties on the egg's surface, analogous to other lysozyme-like proteins involved in gamete interaction. Current research is extremely limited, with only one PubMed reference available. Preliminary findings suggest LYZL6 is expressed in the male reproductive tract and may play a role in sperm-egg recognition and membrane fusion, though detailed functional studies and in vivo validation are lacking. No clinical applications have been established. Given the minimal evidence base, LYZL6 remains an experimental target with no confirmed therapeutic or diagnostic relevance. Further investigation is required to elucidate its precise biological function and potential implications for fertility. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
Molecular weight
16956 g/mol
Research status
experimental
References
1
Tags
uniprot, antimicrobial, bacteriolytic-enzyme, cell-projection, cilium, disulfide-bond, fertilization, flagellum, glycosidase, hydrolase, proteomics-identification, reference-proteome

Mechanism of action

May be involved sperm-egg plasma membrane adhesion and fusion during fertilization (PubMed:28182716). Exhibits bacteriolytic activity in vitro against Micrococcus luteus and Staphylococcus aureus (PubMed:24013621, PubMed:28182716). Shows weak bacteriolytic activity against Gram-positive bacteria at physiological pH (PubMed:28182716). Bacteriolytic activity is pH-dependent, with a maximum at around pH 5.6 (PubMed:28182716)

Research & studies

[Expression of human lysozyme-like protein 6 in the male reproductive system]
Zhonghua nan ke xue = National journal of andrology · 2016 · PubMed

Recombinant LYZL6 showed high bacteriolytic activity against M. lysodeikticus at pH 5.6.; LYZL6 was detected in testis, epididymis, and sperm protein extract, but not in seminal plasma.; Immunohistochemistry localized LYZL6 to late spermatocytes and round spermatids in the testis.; LYZL6 may act as a hydrolase for carbohydrates in zona pellucida penetration.

Frequently asked questions

What is Lysozyme-like protein 6?

Lysozyme-like protein 6 (LYZL6, UniProt O75951) is an experimental protein belonging to the c-type lysozyme/alpha-lactalbumin family. Its proposed mechanism of action involves participation in sperm-egg plasma membrane adhesion and fusion during fertilization, potentially through binding to carbohydrate moieties on the

How does Lysozyme-like protein 6 work?

May be involved sperm-egg plasma membrane adhesion and fusion during fertilization (PubMed:28182716). Exhibits bacteriolytic activity in vitro against Micrococcus luteus and Staphylococcus aureus (PubMed:24013621, PubMed:28182716). Shows weak bacteriolytic activity against Gram-positive bacteria at physiological pH (PubMed:28182716). Bacteriolytic activity is pH-dependent, with a maximum at around

What is the research status of Lysozyme-like protein 6?

Lysozyme-like protein 6 is currently classified as experimental, with 1 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Lysozyme-like protein 6?

Lysozyme-like protein 6 has a molecular weight of approximately 16956 g/mol.

Related peptides

Build on Lysozyme-like protein 6 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key