Late cornified envelope protein 3C

experimental

Also known as: Late envelope protein 15, Small proline-rich-like epidermal differentiation complex protein 3A, LCE3C, Q5T5A8

Late cornified envelope protein 3C (LCE3C) is a structural component of the cornified envelope, a specialized protein-lipid matrix that forms the outermost barrier of the stratum corneum. Its primary mechanism involves cross-linking with other envelope proteins (e.g., involucrin, loricrin) via transglutaminase activity, contributing to mechanical resilience and barrier integrity. Additionally, LCE3C is implicated in innate cutaneous host defense, likely through antimicrobial peptide-like properties that help protect against microbial invasion at the skin surface. Current research on LCE3C remains at an experimental stage, with no published PubMed-indexed studies specifically characterizing its functional roles or disease associations. Given its expression in differentiated keratinocytes and its genomic location within the epidermal differentiation complex, LCE3C may be relevant to skin barrier disorders such as psoriasis or atopic dermatitis, though direct evidence is lacking. Further investigation is needed to clarify its precise contributions to epidermal homeostasis and immune defense. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC
Molecular weight
9729 g/mol
Research status
experimental
Tags
uniprot, antimicrobial, keratinization, proteomics-identification, reference-proteome

Mechanism of action

A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035)

Frequently asked questions

What is Late cornified envelope protein 3C?

Late cornified envelope protein 3C (LCE3C) is a structural component of the cornified envelope, a specialized protein-lipid matrix that forms the outermost barrier of the stratum corneum. Its primary mechanism involves cross-linking with other envelope proteins (e.g., involucrin, loricrin) via transglutaminase activity

How does Late cornified envelope protein 3C work?

A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to ba

What is the research status of Late cornified envelope protein 3C?

Late cornified envelope protein 3C is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Late cornified envelope protein 3C?

Late cornified envelope protein 3C has a molecular weight of approximately 9729 g/mol.

Related peptides

Build on Late cornified envelope protein 3C data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key