Late cornified envelope protein 3B

experimental

Also known as: Late envelope protein 14, LCE3B, Q5TA77

Late cornified envelope protein 3B (LCE3B) is a structural component of the cornified envelope, a specialized protein-lipid matrix that forms the outermost barrier of the stratum corneum. Its primary mechanism involves cross-linking with other envelope proteins (e.g., involucrin, loricrin) via transglutaminase activity, contributing to mechanical resilience and barrier integrity. Additionally, LCE3B is implicated in innate cutaneous host defense, potentially through direct antimicrobial activity or by modulating the skin's response to microbial challenge. Current research on LCE3B remains at an experimental stage, with no peer-reviewed studies indexed in PubMed as of the latest update. Preliminary data suggest its expression may be upregulated in response to epidermal injury or inflammation, but specific functional roles in human skin physiology or pathology have not been characterized. No clinical trials or translational studies have been reported. Given the absence of published research, the clinical relevance of LCE3B is undefined. Its potential as a therapeutic target or biomarker for skin barrier disorders remains speculative. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCC
Molecular weight
9812 g/mol
Research status
experimental
Tags
uniprot, antimicrobial, keratinization, reference-proteome

Mechanism of action

A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035)

Frequently asked questions

What is Late cornified envelope protein 3B?

Late cornified envelope protein 3B (LCE3B) is a structural component of the cornified envelope, a specialized protein-lipid matrix that forms the outermost barrier of the stratum corneum. Its primary mechanism involves cross-linking with other envelope proteins (e.g., involucrin, loricrin) via transglutaminase activity

How does Late cornified envelope protein 3B work?

A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to ba

What is the research status of Late cornified envelope protein 3B?

Late cornified envelope protein 3B is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Late cornified envelope protein 3B?

Late cornified envelope protein 3B has a molecular weight of approximately 9812 g/mol.

Related peptides

Build on Late cornified envelope protein 3B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key