Histone H2B type F-S

experimental

Also known as: H2B-clustered histone 12 like, H2B.S histone 1, Histone H2B.s, H2BC12L, P57053

Histone H2B type F-S (also known as H2B.S histone 1, H2BC12L, UniProt P57053) is a core component of the nucleosome, the fundamental structural unit of chromatin. As a histone variant, it participates in the packaging and compaction of DNA into chromatin, thereby regulating DNA accessibility to transcription, replication, and repair machinery. The mechanism of action involves electrostatic interactions between the positively charged histone proteins and negatively charged DNA, facilitating the winding of DNA around the histone octamer. This structural role is central to epigenetic regulation, as post-translational modifications of histones can alter chromatin dynamics and gene expression. Currently, this protein is classified as an experimental research target with no indexed PubMed references directly associated with its specific function or characterization. The lack of published studies suggests that its precise biological roles, tissue-specific expression, and potential involvement in disease processes remain largely uncharacterized. Given its classification as a histone variant, it may share functional redundancy with other H2B family members, but its unique properties have not been elucidated. Clinical relevance is not established at this time due to the absence of translational research. Without functional validation or disease association studies, Histone H2B type F-S remains a molecular entity of unknown significance in human pathophysiology. Further experimental work is required to determine whether this variant contributes to chromatin regulation in a context-specific manner or represents a non-functional pseudogene. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Molecular weight
13944 g/mol
Research status
experimental
Tags
uniprot, acetylation, adp-ribosylation, antibiotic, antimicrobial, chromosome, direct-protein-sequencing, dna-binding, glycoprotein, hydroxylation, isopeptide-bond, methylation

Mechanism of action

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling

Frequently asked questions

What is Histone H2B type F-S?

Histone H2B type F-S (also known as H2B.S histone 1, H2BC12L, UniProt P57053) is a core component of the nucleosome, the fundamental structural unit of chromatin. As a histone variant, it participates in the packaging and compaction of DNA into chromatin, thereby regulating DNA accessibility to transcription, replicati

How does Histone H2B type F-S work?

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called hi

What is the research status of Histone H2B type F-S?

Histone H2B type F-S is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Histone H2B type F-S?

Histone H2B type F-S has a molecular weight of approximately 13944 g/mol.

Related peptides

Build on Histone H2B type F-S data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key