Histone H2B type 2-E

experimental

Also known as: H2B-clustered histone 21, Histone H2B-GL105, Histone H2B.q, H2BC21, Q16778

Histone H2B type 2-E (also known as H2BC21, H2B-clustered histone 21, or Q16778) is a core structural component of the nucleosome, the fundamental unit of chromatin. As a histone protein, it pairs with other core histones (H2A, H3, and H4) to form the octamer around which approximately 147 base pairs of DNA are wrapped. This packaging compacts genomic DNA into chromatin, thereby regulating the accessibility of DNA to transcription factors, polymerases, and repair enzymes. Post-translational modifications of H2B, such as ubiquitination and acetylation, further modulate chromatin dynamics and gene expression, positioning this histone as a central player in epigenetic regulation. Currently, Histone H2B type 2-E is classified as an experimental protein with no published research indexed in PubMed. Its specific functional roles, tissue distribution, and potential involvement in disease processes remain uncharacterized. Given the general importance of histone variants in development, differentiation, and cancer, future studies may elucidate whether this particular isoform has unique regulatory functions or pathological implications. Clinical relevance for Histone H2B type 2-E has not been established. Without peer-reviewed data, its therapeutic or diagnostic potential cannot be assessed. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Molecular weight
13920 g/mol
Research status
experimental
Tags
uniprot, 3d-structure, acetylation, adp-ribosylation, antibiotic, antimicrobial, chromosome, direct-protein-sequencing, dna-binding, glycoprotein, hydroxylation, isopeptide-bond

Mechanism of action

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling

Frequently asked questions

What is Histone H2B type 2-E?

Histone H2B type 2-E (also known as H2BC21, H2B-clustered histone 21, or Q16778) is a core structural component of the nucleosome, the fundamental unit of chromatin. As a histone protein, it pairs with other core histones (H2A, H3, and H4) to form the octamer around which approximately 147 base pairs of DNA are wrapped

How does Histone H2B type 2-E work?

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called hi

What is the research status of Histone H2B type 2-E?

Histone H2B type 2-E is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Histone H2B type 2-E?

Histone H2B type 2-E has a molecular weight of approximately 13920 g/mol.

Related peptides

Build on Histone H2B type 2-E data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key