Histone H2B type 1-C/E/F/G/I

experimental

Also known as: Histone H2B.1 A, Histone H2B.a, Histone H2B.g, Histone H2B.h, Histone H2B.k, Histone H2B.l, H2BC4, H2BC6, H2BC7, H2BC8, H2BC10, P62807

Histone H2B type 1-C/E/F/G/I (UniProt P62807) is a core histone protein that serves as a fundamental structural component of the nucleosome. Each nucleosome consists of an octamer of two copies each of histones H2A, H2B, H3, and H4, around which approximately 147 base pairs of DNA are wrapped. This packaging compacts DNA into chromatin, thereby regulating access of transcription factors, repair enzymes, and replication machinery to the DNA template. Post-translational modifications of H2B, such as ubiquitination, acetylation, and methylation, further modulate chromatin dynamics and gene expression by altering nucleosome stability and recruiting effector proteins. As an experimental protein with no indexed PubMed references, direct research findings on this specific histone variant are limited. However, studies on H2B family members broadly indicate their involvement in transcriptional regulation, DNA repair, and chromosome segregation. H2B ubiquitination, for instance, is known to facilitate histone H3 methylation and promote transcriptional elongation. Dysregulation of H2B modifications has been implicated in cancer progression and developmental disorders, though variant-specific roles remain to be elucidated. Clinically, H2B type 1-C/E/F/G/I is not currently a validated therapeutic target or biomarker. Its experimental status suggests ongoing characterization of its unique functions relative to other H2B subtypes. Future studies may clarify its relevance in chromatin-related pathologies, but no clinical applications are established at this time. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Molecular weight
13906 g/mol
Research status
experimental
Tags
uniprot, 3d-structure, acetylation, adp-ribosylation, antibiotic, antimicrobial, chromosome, direct-protein-sequencing, dna-binding, glycoprotein, hydroxylation, isopeptide-bond

Mechanism of action

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling

Frequently asked questions

What is Histone H2B type 1-C/E/F/G/I?

Histone H2B type 1-C/E/F/G/I (UniProt P62807) is a core histone protein that serves as a fundamental structural component of the nucleosome. Each nucleosome consists of an octamer of two copies each of histones H2A, H2B, H3, and H4, around which approximately 147 base pairs of DNA are wrapped. This packaging compacts D

How does Histone H2B type 1-C/E/F/G/I work?

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called hi

What is the research status of Histone H2B type 1-C/E/F/G/I?

Histone H2B type 1-C/E/F/G/I is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Histone H2B type 1-C/E/F/G/I?

Histone H2B type 1-C/E/F/G/I has a molecular weight of approximately 13906 g/mol.

Related peptides

Build on Histone H2B type 1-C/E/F/G/I data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key