Histatin-3
experimentalAlso known as: Basic histidine-rich protein, Histatin 3, Histidine-rich protein 3, PB, HTN3, P15516
**Mechanism of Action** Histatin-3 (HTN3) is a cationic, histidine-rich antimicrobial peptide secreted by the parotid and submandibular salivary glands. Its mechanism involves binding to microbial cell membranes via electrostatic interactions, followed by membrane disruption and pore formation. Additionally, Histatin-3 exhibits metal-chelating properties, particularly for zinc and copper, which may inhibit microbial metalloproteases and biofilm formation. It also modulates host immune responses by promoting wound healing and angiogenesis through activation of the MAPK/ERK signaling pathway in epithelial cells. **Key Research Findings** Preclinical studies demonstrate broad-spectrum antifungal activity against *Candida albicans*, including azole-resistant strains, via mitochondrial dysfunction and reactive oxygen species generation. Histatin-3 also shows antibacterial effects against oral pathogens such as *Streptococcus mutans* and *Porphyromonas gingivalis*. Research indicates its role in oral mucosal repair, with accelerated wound closure in vitro and in animal models. However, its clinical translation remains limited due to rapid proteolytic degradation in saliva and variable in vivo efficacy. **Clinical Relevance** Histatin-3 is under investigation for applications in oral candidiasis, periodontal disease, and post-surgical wound healing. Synthetic analogs with enhanced stability are being developed to overcome bioavailability challenges. Current evidence is restricted to experimental models, with no approved therapeutic formulations. For research purposes only — not medical advice.
Key data
MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDNC178H258N64O48Mechanism of action
Histatins are cationic and histidine-rich peptides mainly found in the saliva of higher primates (PubMed:3286634). They are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can be divided into two major groups according to their biological functions: antimicrobial Hsts (e.g. Hst 5/HTN3) and cell-activating Hsts (e.g. Hst 1/HTN1, Hst 2/HTN1 and Hst 3/HTN3) (PubMed:32225006)
Research & studies
Histatin-3 and -5 polymerize G-actin to F-actin and bundle F-actin filaments.; Actin polymerization and bundling by histatins increase with decreasing pH.; Histatin-3 binds stronger to actin and affects actin structure at lower concentrations than histatin-5.; Histatin-induced actin bundles are dissociated by NaCl, indicating electrostatic interactions.
Frequently asked questions
What is Histatin-3?
**Mechanism of Action** Histatin-3 (HTN3) is a cationic, histidine-rich antimicrobial peptide secreted by the parotid and submandibular salivary glands. Its mechanism involves binding to microbial cell membranes via electrostatic interactions, followed by membrane disruption and pore formation. Additionally, Histatin-3
How does Histatin-3 work?
Histatins are cationic and histidine-rich peptides mainly found in the saliva of higher primates (PubMed:3286634). They are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can be divided into two major groups according to their biological functions: antimicrobial Hsts (e.g. Hst 5/HTN3) and cell-activating Hsts (e.g. Hst 1/HTN1,
What is the research status of Histatin-3?
Histatin-3 is currently classified as experimental, with 74 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Histatin-3?
Histatin-3 has a molecular weight of approximately 4062 g/mol (formula C178H258N64O48).
Related peptides
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
Human cathelicidin antimicrobial peptide with broad-spectrum antibacterial, immunomodulatory, and wound-healing activity.
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization i…
Antimicrobial protein that kills intracellular pathogens.
28-aa thymic peptide that enhances T-cell maturation and TLR signaling; approved in many countries for hepatitis and as an immune adjuvant.
Zinc-dependent thymic nonapeptide that regulates T-cell differentiation and has analgesic and anti-inflammatory effects.
Build on Histatin-3 data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key