Histatin-3

experimental

Also known as: Basic histidine-rich protein, Histatin 3, Histidine-rich protein 3, PB, HTN3, P15516

**Mechanism of Action** Histatin-3 (HTN3) is a cationic, histidine-rich antimicrobial peptide secreted by the parotid and submandibular salivary glands. Its mechanism involves binding to microbial cell membranes via electrostatic interactions, followed by membrane disruption and pore formation. Additionally, Histatin-3 exhibits metal-chelating properties, particularly for zinc and copper, which may inhibit microbial metalloproteases and biofilm formation. It also modulates host immune responses by promoting wound healing and angiogenesis through activation of the MAPK/ERK signaling pathway in epithelial cells. **Key Research Findings** Preclinical studies demonstrate broad-spectrum antifungal activity against *Candida albicans*, including azole-resistant strains, via mitochondrial dysfunction and reactive oxygen species generation. Histatin-3 also shows antibacterial effects against oral pathogens such as *Streptococcus mutans* and *Porphyromonas gingivalis*. Research indicates its role in oral mucosal repair, with accelerated wound closure in vitro and in animal models. However, its clinical translation remains limited due to rapid proteolytic degradation in saliva and variable in vivo efficacy. **Clinical Relevance** Histatin-3 is under investigation for applications in oral candidiasis, periodontal disease, and post-surgical wound healing. Synthetic analogs with enhanced stability are being developed to overcome bioavailability challenges. Current evidence is restricted to experimental models, with no approved therapeutic formulations. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
Molecular weight
4062 g/mol
Molecular formula
C178H258N64O48
CAS number
112844-49-2
Research status
experimental
References
74
Tags
uniprot, antibiotic, antimicrobial, biomineralization, cleavage-on-pair-of-basic-residues, direct-protein-sequencing, fungicide, immunity, innate-immunity, metal-binding, mitochondrion, proteomics-identification

Mechanism of action

Histatins are cationic and histidine-rich peptides mainly found in the saliva of higher primates (PubMed:3286634). They are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can be divided into two major groups according to their biological functions: antimicrobial Hsts (e.g. Hst 5/HTN3) and cell-activating Hsts (e.g. Hst 1/HTN1, Hst 2/HTN1 and Hst 3/HTN3) (PubMed:32225006)

Research & studies

Histatin-Photodynamic Therapy for Polyene-Resistant Biofilms in a 3D Model
Journal of dental research · 2025 · PubMed
Salivary proteins-enhanced antimicrobial photodynamic therapy: Overcoming three distinct cultures of resistant mixed biofilms
Journal of dentistry · 2025 · PubMed
Indirect ELISA-based detection of histatin 3 and cystatin D for the forensic identification of human saliva
Analytical methods : advancing methods and applications · 2025 · PubMed
Zn(II) coordination influences the secondary structure, but not antimicrobial activity of the N-terminal histatin 3 hydrolysis product
Dalton transactions (Cambridge, England : 2003) · 2024 · PubMed
One-tube, two-step isothermal amplification of histatin 3 mRNA for saliva screening
Forensic science international · 2023 · PubMed
Interactions of histatin-3 and histatin-5 with actin
BMC biochemistry · 2017 · PubMed

Histatin-3 and -5 polymerize G-actin to F-actin and bundle F-actin filaments.; Actin polymerization and bundling by histatins increase with decreasing pH.; Histatin-3 binds stronger to actin and affects actin structure at lower concentrations than histatin-5.; Histatin-induced actin bundles are dissociated by NaCl, indicating electrostatic interactions.

Histatin peptides: Pharmacological functions and their applications in dentistry
Saudi pharmaceutical journal : SPJ : the official publication of the Saudi Pharmaceutical Society · 2017 · PubMed
Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination
Biochemical and biophysical research communications · 2016 · PubMed

Frequently asked questions

What is Histatin-3?

**Mechanism of Action** Histatin-3 (HTN3) is a cationic, histidine-rich antimicrobial peptide secreted by the parotid and submandibular salivary glands. Its mechanism involves binding to microbial cell membranes via electrostatic interactions, followed by membrane disruption and pore formation. Additionally, Histatin-3

How does Histatin-3 work?

Histatins are cationic and histidine-rich peptides mainly found in the saliva of higher primates (PubMed:3286634). They are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can be divided into two major groups according to their biological functions: antimicrobial Hsts (e.g. Hst 5/HTN3) and cell-activating Hsts (e.g. Hst 1/HTN1,

What is the research status of Histatin-3?

Histatin-3 is currently classified as experimental, with 74 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Histatin-3?

Histatin-3 has a molecular weight of approximately 4062 g/mol (formula C178H258N64O48).

Related peptides

Build on Histatin-3 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key