Histatin-1

experimental

Also known as: Histidine-rich protein 1, Post-PB protein, HTN1, P15515

**Mechanism of Action** Histatin-1 is a cationic, histidine-rich antimicrobial peptide secreted primarily by human salivary glands. Its mechanism involves binding to microbial cell membranes via electrostatic interactions, leading to membrane disruption and pore formation. Additionally, Histatin-1 promotes wound healing by enhancing epithelial cell migration, adhesion, and angiogenesis through activation of the ERK1/2 and PI3K/Akt signaling pathways. It also exhibits antifungal activity, particularly against *Candida albicans*, by targeting mitochondrial function and inducing reactive oxygen species (ROS) accumulation. **Key Research Findings** Preclinical studies demonstrate Histatin-1’s broad-spectrum antimicrobial effects, including bactericidal activity against oral pathogens like *Streptococcus mutans* and *Porphyromonas gingivalis*. In vitro and in vivo models show accelerated re-epithelialization and closure of oral mucosal wounds, with reduced inflammation. Research also highlights its role in maintaining oral homeostasis by modulating biofilm formation and inhibiting fungal hyphal transition. However, its clinical translation remains experimental, with limited human trials. **Clinical Relevance** Histatin-1 is under investigation for applications in oral mucositis, periodontal disease, and chronic wound management. Its natural origin and low toxicity profile make it a promising candidate for topical formulations. Current evidence supports its potential as an adjunctive therapy for oral infections and tissue repair, though further studies are needed to establish efficacy and safety in humans. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Molecular weight
270.08 g/mol
Molecular formula
C10H8BrNO3
CAS number
1090903-69-7
Research status
experimental
References
136
Tags
uniprot, antibiotic, antimicrobial, biomineralization, direct-protein-sequencing, endoplasmic-reticulum, fungicide, membrane, mitochondrion, phosphoprotein, proteomics-identification, reference-proteome

Mechanism of action

Histatins (Hsts) are cationic and histidine-rich secreted peptides mainly synthesized by saliva glands of humans and higher primates (PubMed:3286634, PubMed:3944083). Hsts are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can be divided into two major groups according to their biological functions: antimicrobial Hsts (e.g. Hst 5/HTN3) and cell-activating Hsts (e.g. Hst 1/HTN1 and Hst 2/HTN1) (PubMed:32225006). Hst 1/HTN1 and Hst 2/HTN1 act in different cell types (epithelium, fibroblasts and endothelium) in oral and non-oral mucosa (PubMed:25903106, PubMed:28542418, PubMed:28751526, PubMed:32225006)

Research & studies

Investigation of histatin-1, histatin-3, and histatin-5 peptide levels in corneal epithelial cells obtained from patients with keratoconus
European journal of ophthalmology · 2026 · PubMed

Histatin-3 levels significantly increased in stage 1 (528.17 ng/mg) and stage 2 (374.33 ng/mg) compared to controls (274.05 ng/mg).; No significant changes in histatin-1 or histatin-5 levels were observed across stages.; Corneal epithelial cell thickness increased proportionally with keratoconus stage.; Positive correlations between histatin-1 and histatin-3 levels were found in all stages.

Human salivary histatin 1 regulating IP3R1/GRP75/VDAC1 mediated mitochondrial-associated endoplasmic reticulum membranes (MAMs) inhibits cell senescence for diabetic wound repair
Free radical biology & medicine · 2024 · PubMed

Hst1 decreases senescence markers (SA-β-gal, p53, p21, p16) in HUVECs via ERK-mediated Nrf2 nuclear translocation and antioxidant response.; Hst1 inhibits MAM formation by disrupting IP3R1/GRP75/VDAC1 complex interactions, reducing ER-to-mitochondria Ca2+ transfer and mitochondrial Ca2+ overload.; In diabetic mice, Hst1 promotes wound healing by stimulating new blood vessel formation and suppressing senescent biomarker expression.

IN VITRO ANTICANCER ACTIVITY OF HISTATIN-1 COMBINATION WITH CISPLATIN IN HEAD AND NECK CANCER CELL LINES
Experimental oncology · 2024 · PubMed
The salivary peptide histatin-1 enhances bone repair in vivo
Biochemical and biophysical research communications · 2023 · PubMed

Histatin-1 increased intraosseous mineralization and collagen matrix deposition in tibial defects.; Histatin-1 promoted closure of cortical defect edges.; Histatin-1 upregulated the osteogenic marker alkaline phosphatase.; Histatin-1 augmented blood vessel formation in the defect area.

Human Salivary Histatin-1 Attenuates Osteoarthritis through Promoting M1/M2 Macrophage Transition
Pharmaceutics · 2023 · PubMed
Histatin-1 alleviates high-glucose injury to skin keratinocytes through MAPK signaling pathway
Journal of cosmetic dermatology · 2022 · PubMed
Identification of VEGFR2 as the Histatin-1 receptor in endothelial cells
Biochemical pharmacology · 2022 · PubMed
Histatin-1 is an endogenous ligand of the sigma-2 receptor
The FEBS journal · 2021 · PubMed

Frequently asked questions

What is Histatin-1?

**Mechanism of Action** Histatin-1 is a cationic, histidine-rich antimicrobial peptide secreted primarily by human salivary glands. Its mechanism involves binding to microbial cell membranes via electrostatic interactions, leading to membrane disruption and pore formation. Additionally, Histatin-1 promotes wound healin

How does Histatin-1 work?

Histatins (Hsts) are cationic and histidine-rich secreted peptides mainly synthesized by saliva glands of humans and higher primates (PubMed:3286634, PubMed:3944083). Hsts are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can be divided into two major groups according to their biological functions: antimicrobial Hsts (e.g. Hst

What is the research status of Histatin-1?

Histatin-1 is currently classified as experimental, with 136 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Histatin-1?

Histatin-1 has a molecular weight of approximately 270.08 g/mol (formula C10H8BrNO3).

Related peptides

Build on Histatin-1 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key