Galanin-like peptide
experimentalAlso known as: GALP, Q9UBC7
Galanin-like peptide (GALP) is a 60-amino-acid hypothalamic neuropeptide that binds with high affinity to the galanin receptors GALR1, GALR2, and GALR3, which are G-protein-coupled receptors. Activation of these receptors modulates intracellular signaling pathways, including inhibition of adenylate cyclase and activation of mitogen-activated protein kinase (MAPK) cascades. GALP is primarily expressed in the arcuate nucleus and median eminence, and its release is regulated by metabolic and hormonal cues such as leptin and insulin, positioning it as a key modulator of energy homeostasis and neuroendocrine function. Preclinical studies have demonstrated that central administration of GALP in rodents induces acute feeding behavior, followed by a delayed suppression of food intake and increased energy expenditure, suggesting a biphasic role in appetite regulation. Additionally, GALP influences reproductive function by stimulating luteinizing hormone (LH) secretion via interactions with gonadotropin-releasing hormone (GnRH) neurons. Research also indicates GALP’s involvement in thermoregulation, stress responses, and glucose metabolism, with effects mediated through distinct receptor subtypes and neural circuits. Despite its experimental status, GALP holds potential clinical relevance for disorders involving energy balance dysregulation, such as obesity and cachexia, as well as reproductive and metabolic syndromes. However, its therapeutic application remains limited by the complexity of its receptor interactions and the need for targeted delivery systems. Further research is required to elucidate its full physiological roles and translational potential. For research purposes only — not medical advice.
Key data
MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKSC106H170N28O29SMechanism of action
Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1, GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
Research & studies
Primate-biased galanin-like peptide (GALP) signaling was identified in the anteroventral telencephalon.; Regional transcriptomic variations were observed along the frontotemporal axis during neocortical NSC progression.; Genes associated with neuropsychiatric disorders and brain cancer risk may play critical roles in early telencephalic organizers and NSC progression.
Serum GALP levels were significantly higher in PCOS patients than controls (p = 0.001).; GALP was positively correlated with total testosterone (r = 0.265, p = 0.024) and negatively correlated with 25-hydroxyvitamin D (r = -0.401, p = 0.002).; Total testosterone and 25-hydroxyvitamin D significantly contributed to GALP levels in multiple regression analysis.; Waist circumference and Ferriman-Gallwey score were significantly higher in PCOS patients, while 25-hydroxyvitamin D was lower.
Frequently asked questions
What is Galanin-like peptide?
Galanin-like peptide (GALP) is a 60-amino-acid hypothalamic neuropeptide that binds with high affinity to the galanin receptors GALR1, GALR2, and GALR3, which are G-protein-coupled receptors. Activation of these receptors modulates intracellular signaling pathways, including inhibition of adenylate cyclase and activati
How does Galanin-like peptide work?
Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1, GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
What is the research status of Galanin-like peptide?
Galanin-like peptide is currently classified as experimental, with 184 research references on record. This is for research purposes only and is not medical advice.
What is the molecular weight of Galanin-like peptide?
Galanin-like peptide has a molecular weight of approximately 2332.7 g/mol (formula C106H170N28O29S).
Related peptides
Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
Human cathelicidin antimicrobial peptide with broad-spectrum antibacterial, immunomodulatory, and wound-healing activity.
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization i…
Antimicrobial protein that kills intracellular pathogens.
28-aa thymic peptide that enhances T-cell maturation and TLR signaling; approved in many countries for hepatitis and as an immune adjuvant.
Zinc-dependent thymic nonapeptide that regulates T-cell differentiation and has analgesic and anti-inflammatory effects.
Build on Galanin-like peptide data programmatically
Structured peptide data, semantic search, and AI summaries via one API.
Get a free API key