Defensin-6

experimental

Also known as: Defensin, alpha 6, DEFA6, Q01524

**Mechanism of Action** Defensin-6 (DEFA6) is a host-defense peptide expressed primarily in Paneth cells of the small intestine. It exerts antimicrobial activity through the formation of higher-order oligomers (nanonets) that physically entrap bacteria, preventing microbial adhesion and invasion of the intestinal epithelium. This mechanism is distinct from membrane disruption, relying instead on self-assembly into fibrillar structures that immobilize pathogens and maintain mucosal barrier integrity. DEFA6 also modulates innate immune signaling, though its direct bactericidal effects are limited compared to other alpha-defensins. **Key Research Findings** Preclinical studies demonstrate that DEFA6 oligomerization is calcium-dependent and requires specific disulfide bonding patterns for structural stability. In murine models, DEFA6 deficiency leads to increased bacterial translocation and susceptibility to enteric infections, highlighting its role in gut homeostasis. Human studies show reduced DEFA6 expression in inflammatory bowel disease (IBD), particularly Crohn’s disease, correlating with impaired antimicrobial defense. Experimental evidence also suggests DEFA6 interacts with the gut microbiome, selectively targeting Gram-negative bacteria while sparing commensals. **Clinical Relevance** DEFA6 is under investigation as a biomarker for intestinal barrier dysfunction and as a therapeutic target for IBD and infectious colitis. Its ability to form nanonets offers a novel approach to antimicrobial therapy, potentially reducing reliance on broad-spectrum antibiotics. However, clinical applications remain experimental, with no approved therapies to date. Further research is needed to elucidate its role in chronic inflammation and to develop stable peptide analogs for clinical use. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Molecular weight
10975 g/mol
Research status
experimental
References
61
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, cytoplasmic-vesicle, defensin, direct-protein-sequencing, disulfide-bond, fungicide, immunity, innate-immunity, proteomics-identification

Mechanism of action

Host-defense peptide that contributes to intestinal innate immunity and mediates homeostasis at mucosal surfaces by forming higher-order oligomers that capture bacteria and prevent microbial invasion of the epithelium (PubMed:15616305, PubMed:17088326, PubMed:25158166, PubMed:25354318, PubMed:28026958). After binding to bacterial surface proteins, undergoes ordered self-assembly to form fibril-like nanonets that surround and entangle bacteria and thereby prevent bacterial invasion across the epithelial barrier (PubMed:22722251). Entangles and agglutinates Gram-negative bacteria, such as E.coli, S.typhimurium and Y.enterocolitica, and Gram-positive bacteria such as L.monocytogenes, thereby protecting the intestine against invasion by enteric bacterial pathogens (PubMed:22722251, PubMed:25158166, PubMed:27076903). Blocks adhesion of C.albicans to intestinal epithelial cells and thereby suppresses fungal invasion of epithelial cells and biofilm formation (PubMed:28026958). Under reducing conditions and in an acidic environment similar to the intestinal milieu, exhibits inhibitory activity against anaerobic bacteria such as B.adolescentis, L.acidophilus and B.breve, as well as B.longum and S.thermophilus, possibly by leading to alterations in bacterial cell envelope structures (PubMed:25354318). The disulfide-linked oxidized form exhibits negligible antimicrobial activity against Gram-negative and Gram-positive bacteria, as compared to the enteric defensin DEFA5 (PubMed:15616305, PubMed:17088326)

Research & studies

The gut microbiota posttranslationally modifies IgA1 in autoimmune glomerulonephritis
Science translational medicine · 2024 · PubMed

Increased abundance of mucin-degrading bacteria, including Akkermansia muciniphila, in the gut microbiota of IgA nephropathy patients.; A. muciniphila deglycosylates IgA1 in vitro and in the mouse gut lumen, creating neo-epitopes recognized by patient autoreactive IgG.; Mice expressing human IgA1 and CD89 with A. muciniphila colonization developed aggravated IgA nephropathy with IgA1 deposition in glomeruli.; Human α-defensins inhibit A. muciniphila growth, and their negative correlation with A. muciniphila in controls is lost in patients.

Evolving and assembling to pierce through: Evolutionary and structural aspects of antimicrobial peptides
Computational and structural biotechnology journal · 2022 · PubMed
Human α-Defensin-6 Neutralizes Clostridioides difficile Toxins TcdA and TcdB by Direct Binding
International journal of molecular sciences · 2022 · PubMed

α-Defensin-6 prevented toxin-mediated glucosylation of Rho-GTPases in cells.; It protected human cells, epithelial barriers, and zebrafish embryos from toxic effects.; Direct binding to TcdB was shown via SPR, and TcdB/α-defensin-6 complexes formed rapidly.; The defensin sequesters toxins into complexes, preventing cytotoxic activity.

Human α-defensin 6 (HD6) suppresses CRC proliferation and metastasis through abolished EGF/EGFR signaling pathway
International journal of medical sciences · 2022 · PubMed
Disruption of the endopeptidase ADAM10-Notch signaling axis leads to skin dysbiosis and innate lymphoid cell-mediated hair follicle destruction
Immunity · 2021 · PubMed
A biomimetic peptide recognizes and traps bacteria in vivo as human defensin-6
Science advances · 2020 · PubMed
Human α-Defensin 6: A Small Peptide That Self-Assembles and Protects the Host by Entangling Microbes
Accounts of chemical research · 2017 · PubMed
Human α-Defensin 6 Self-Assembly Prevents Adhesion and Suppresses Virulence Traits of Candida albicans
Biochemistry · 2017 · PubMed

Frequently asked questions

What is Defensin-6?

**Mechanism of Action** Defensin-6 (DEFA6) is a host-defense peptide expressed primarily in Paneth cells of the small intestine. It exerts antimicrobial activity through the formation of higher-order oligomers (nanonets) that physically entrap bacteria, preventing microbial adhesion and invasion of the intestinal epith

How does Defensin-6 work?

Host-defense peptide that contributes to intestinal innate immunity and mediates homeostasis at mucosal surfaces by forming higher-order oligomers that capture bacteria and prevent microbial invasion of the epithelium (PubMed:15616305, PubMed:17088326, PubMed:25158166, PubMed:25354318, PubMed:28026958). After binding to bacterial surface proteins, undergoes ordered self-assembly to form fibril-lik

What is the research status of Defensin-6?

Defensin-6 is currently classified as experimental, with 61 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Defensin-6?

Defensin-6 has a molecular weight of approximately 10975 g/mol.

Related peptides

Build on Defensin-6 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key