C-X-C motif chemokine 6

experimental

Also known as: Chemokine alpha 3, Granulocyte chemotactic protein 2, Small-inducible cytokine B6, CXCL6, P80162

**Mechanism of Action** C-X-C motif chemokine 6 (CXCL6), also known as granulocyte chemotactic protein 2 (GCP-2), is a member of the CXC chemokine family. It exerts its biological effects primarily by binding to the chemokine receptors CXCR1 and CXCR2, which are expressed on the surface of neutrophil granulocytes. This interaction triggers intracellular signaling cascades, including activation of the MAPK and PI3K pathways, leading to directed chemotaxis, degranulation, and respiratory burst in neutrophils. CXCL6 also promotes angiogenesis and tissue remodeling through its effects on endothelial cells. **Key Research Findings** Preclinical studies have demonstrated that CXCL6 is upregulated in inflammatory conditions such as rheumatoid arthritis, chronic obstructive pulmonary disease, and bacterial infections, where it amplifies neutrophil recruitment to sites of tissue damage. Elevated CXCL6 levels correlate with disease severity in sepsis and inflammatory bowel disease models. Conversely, CXCL6 blockade reduces neutrophil infiltration and tissue injury in murine models of acute lung injury and arthritis. Limited evidence also suggests a role in tumor progression, as CXCL6 expression in certain cancers (e.g., colorectal, pancreatic) is associated with enhanced angiogenesis and metastasis. **Clinical Relevance** CXCL6 remains an experimental target with no approved clinical applications. Its potential as a therapeutic target lies in modulating neutrophil-driven inflammation, particularly in chronic inflammatory and autoimmune diseases. However, the redundancy of the chemokine system (overlapping functions with CXCL8/IL-8) and the risk of immunosuppression pose challenges. Current research focuses on developing selective CXCR1/2 antagonists and evaluating CXCL6 as a biomarker for disease activity. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Molecular weight
11897 g/mol
Research status
experimental
References
13
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, chemotaxis, cytokine, direct-protein-sequencing, disulfide-bond, heparin-binding, proteomics-identification, reference-proteome, secreted

Mechanism of action

Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-negative bacteria (90-fold-higher when compared to CXCL5 and CXCL7)

Research & studies

Mendelian randomization reveals contrasting effects of immune signaling molecules on bone and articular cartilage malignancies
Discover oncology · 2025 · PubMed
Causal relationship between circulating inflammatory proteins and atherosclerosis: a bidirectional Mendelian randomization study and meta-analysis
Journal of cardiology · 2025 · PubMed

Elevated artemin, hGDNF, and TNF increase peripheral atherosclerosis risk.; Higher IL-8, CUB domain-containing protein 1, and others decrease cerebral artery atherosclerosis risk.; FGF-21, hGDNF, and IL-22RA1 are risk factors for coronary artery atherosclerosis; IL-13 and TNF-beta are protective.; CXCL6 and hGDNF increase overall atherosclerosis risk, while IL-6 is protective.

Research based on nucleotide polymorphism reveals the role of inflammatory cytokines in regulating the influence of blood metabolites on drug-related osteonecrosis
Archives of medical science : AMS · 2025 · PubMed
Causal inference of inflammatory proteins in infertility: a Mendelian randomization study
Frontiers in endocrinology · 2025 · PubMed
Targeting Deltex E3 Ubiquitin Ligase 2 Inhibits Tumor-associated Neutrophils and Sensitizes Hepatocellular Carcinoma Cells to Immunotherapy
Advanced science (Weinheim, Baden-Wurttemberg, Germany) · 2025 · PubMed

DTX2 promotes TAN infiltration and polarization toward a protumor phenotype, attenuating CD8+ T cell cytotoxicity partially through CXCL2 and CXCL6.; DTX2 interacts with histone H2B and enhances its monoubiquitination at lysine120 (H2BK120ub1), increasing CXCL2 and CXCL6 transcription via epigenetic regulation.; DTX2 inhibitor treatment inhibited tumor growth and sensitized HCC cells to PD-1 antibody therapy in multiple in vivo tumor models.

Causal relationship between circulating inflammatory proteins and risk of different types of encephalitis: A two-sample Mendelian randomization study
Cytokine · 2024 · PubMed
Exploring the effect of lifestyle behaviors and socioeconomic status on atrial fibrillation: the mediating role of 91 inflammatory cytokines
Frontiers in cardiovascular medicine · 2024 · PubMed
The mammosphere-derived epithelial cell secretome modulates neutrophil functions in the bovine model
Frontiers in immunology · 2024 · PubMed

Frequently asked questions

What is C-X-C motif chemokine 6?

**Mechanism of Action** C-X-C motif chemokine 6 (CXCL6), also known as granulocyte chemotactic protein 2 (GCP-2), is a member of the CXC chemokine family. It exerts its biological effects primarily by binding to the chemokine receptors CXCR1 and CXCR2, which are expressed on the surface of neutrophil granulocytes. This

How does C-X-C motif chemokine 6 work?

Chemotactic for neutrophil granulocytes. Signals through binding and activation of its receptors (CXCR1 and CXCR2). In addition to its chemotactic and angiogenic properties, it has strong antibacterial activity against Gram-positive and Gram-negative bacteria (90-fold-higher when compared to CXCL5 and CXCL7)

What is the research status of C-X-C motif chemokine 6?

C-X-C motif chemokine 6 is currently classified as experimental, with 13 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of C-X-C motif chemokine 6?

C-X-C motif chemokine 6 has a molecular weight of approximately 11897 g/mol.

Related peptides

Build on C-X-C motif chemokine 6 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key