Beta-defensin 135

experimental

Also known as: Defensin, beta 135, DEFB135, Q30KP9

**Mechanism of Action:** Beta-defensin 135 (DEFB135) is a predicted member of the beta-defensin family, a class of antimicrobial peptides characterized by a conserved beta-sheet structure stabilized by three disulfide bonds. Based on homology to other beta-defensins, its proposed mechanism involves direct interaction with microbial membranes via electrostatic attraction to negatively charged bacterial phospholipids, followed by membrane disruption through pore formation or detergent-like activity. This leads to bacterial cell lysis and death. The peptide is encoded by the *DEFB135* gene (UniProt ID Q30KP9) and is expressed in epithelial tissues, consistent with a role in innate immune defense. **Key Research Findings:** Currently, no peer-reviewed experimental studies have been published on beta-defensin 135. Its classification as "EXPERIMENTAL" reflects that its existence is predicted from genomic sequencing, but functional validation—including antimicrobial activity, expression patterns, or structural characterization—remains absent in the scientific literature. No PubMed references are available, and no in vitro or in vivo data confirm its proposed antibacterial effects. **Clinical Relevance:** Without experimental evidence, beta-defensin 135 has no established clinical relevance. Its potential as a therapeutic agent or biomarker is purely speculative at this stage. Further research is required to confirm its antimicrobial activity, spectrum of action, and safety profile before any translational applications can be considered. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDTIHLCCVNPKYLPILTGK
Molecular weight
8754 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 135?

**Mechanism of Action:** Beta-defensin 135 (DEFB135) is a predicted member of the beta-defensin family, a class of antimicrobial peptides characterized by a conserved beta-sheet structure stabilized by three disulfide bonds. Based on homology to other beta-defensins, its proposed mechanism involves direct interaction w

How does Beta-defensin 135 work?

Has antibacterial activity

What is the research status of Beta-defensin 135?

Beta-defensin 135 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 135?

Beta-defensin 135 has a molecular weight of approximately 8754 g/mol.

Related peptides

Build on Beta-defensin 135 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key