Beta-defensin 134

experimental

Also known as: Defensin, beta 134, DEFB134, Q4QY38

Beta-defensin 134 (DEFB134) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent cell lysis. This cationic peptide is thought to target negatively charged microbial membranes, a common feature among defensins, though its specific binding affinity and selectivity remain uncharacterized due to limited experimental data. As of current literature, no peer-reviewed research findings have been published on DEFB134. Its status as an experimental peptide suggests it has been identified through genomic or transcriptomic analyses, but functional studies, including antimicrobial activity assays or in vivo models, have not been conducted. The absence of PubMed references indicates that its antibacterial properties are inferred from homology to other beta-defensins rather than direct evidence. Given the lack of experimental validation, the clinical relevance of beta-defensin 134 is entirely speculative. It may represent a candidate for future antimicrobial development, particularly in the context of rising antibiotic resistance, but no therapeutic applications can be considered without further investigation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP
Molecular weight
7552 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 134?

Beta-defensin 134 (DEFB134) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequen

How does Beta-defensin 134 work?

Has antibacterial activity

What is the research status of Beta-defensin 134?

Beta-defensin 134 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 134?

Beta-defensin 134 has a molecular weight of approximately 7552 g/mol.

Related peptides

Build on Beta-defensin 134 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key