Beta-defensin 133

experimental

Also known as: Defensin, beta 133, DEFB133, Q30KQ1

Beta-defensin 133 (DEFB133) is a predicted member of the beta-defensin family of antimicrobial peptides, encoded by the *DEFB133* gene. Its proposed mechanism of action involves direct antibacterial activity, likely through electrostatic interaction with bacterial cell membranes, leading to membrane disruption and pathogen killing. However, no functional validation or experimental characterization has been published to date. As of now, there are no peer-reviewed research findings in PubMed or other major databases confirming the expression, antimicrobial spectrum, or in vivo activity of DEFB133. Its status remains purely experimental, based on genomic and bioinformatic predictions rather than empirical data. Given the absence of experimental evidence, DEFB133 has no established clinical relevance. It is not approved for therapeutic use, and no safety or efficacy data exist. Further research is required to determine its biological function and potential applications. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKIHVFLFVLFFFLVPIATRVKCAVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM
Molecular weight
7213 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 133?

Beta-defensin 133 (DEFB133) is a predicted member of the beta-defensin family of antimicrobial peptides, encoded by the *DEFB133* gene. Its proposed mechanism of action involves direct antibacterial activity, likely through electrostatic interaction with bacterial cell membranes, leading to membrane disruption and path

How does Beta-defensin 133 work?

Has antibacterial activity

What is the research status of Beta-defensin 133?

Beta-defensin 133 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 133?

Beta-defensin 133 has a molecular weight of approximately 7213 g/mol.

Related peptides

Build on Beta-defensin 133 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key