Beta-defensin 132

experimental

Also known as: Beta-defensin 32, Defensin HEL-75, Defensin, beta 132, DEFB132, Q7Z7B7

Beta-defensin 132 (DEFB132), also referred to as beta-defensin 32 or defensin HEL-75, is an antimicrobial peptide encoded by the *DEFB132* gene. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial cell membranes via electrostatic interactions, a common feature among beta-defensins. This peptide is classified as experimental, with no published PubMed-indexed studies currently available to confirm its specific spectrum of activity, potency, or structural characteristics. Given the absence of peer-reviewed research, key findings regarding its efficacy, target pathogens, or in vivo functions remain undefined. The lack of experimental data limits any assessment of its therapeutic potential or biological role in host defense. Clinical relevance is currently speculative, as no translational studies or applications have been reported. Further investigation is required to validate its antibacterial properties and explore possible utility in infection control or immune modulation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Molecular weight
10610 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 132?

Beta-defensin 132 (DEFB132), also referred to as beta-defensin 32 or defensin HEL-75, is an antimicrobial peptide encoded by the *DEFB132* gene. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial cell membranes via electrostatic interactions, a common feature

How does Beta-defensin 132 work?

Has antibacterial activity

What is the research status of Beta-defensin 132?

Beta-defensin 132 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 132?

Beta-defensin 132 has a molecular weight of approximately 10610 g/mol.

Related peptides

Build on Beta-defensin 132 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key