Beta-defensin 131B

experimental

Also known as: Defensin, beta 131, DEFB131B, A0A096LNP1

Beta-defensin 131B (DEFB131B, UniProt A0A096LNP1) is an experimental antimicrobial peptide belonging to the beta-defensin family. Its proposed mechanism of action involves direct antibacterial activity, likely through disruption of bacterial cell membranes via electrostatic interactions with negatively charged microbial surfaces, leading to pore formation and cell lysis. This mechanism is characteristic of defensins, which are cationic, cysteine-rich peptides that play a role in innate immune defense against pathogens. Currently, there are no published peer-reviewed studies indexed in PubMed specifically investigating beta-defensin 131B. Research status remains experimental, with no validated functional data or in vivo models available. The lack of primary literature limits understanding of its spectrum of activity, potency, or potential synergy with other immune factors. Further studies are required to confirm its antibacterial efficacy and elucidate its biological role. Given the absence of clinical data, beta-defensin 131B has no established therapeutic relevance at this time. Its potential applications in antimicrobial therapy remain speculative until rigorous preclinical and clinical evaluations are conducted. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRVLFFVFGVLSLMSTVPPTRSFTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW
Molecular weight
8156 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 131B?

Beta-defensin 131B (DEFB131B, UniProt A0A096LNP1) is an experimental antimicrobial peptide belonging to the beta-defensin family. Its proposed mechanism of action involves direct antibacterial activity, likely through disruption of bacterial cell membranes via electrostatic interactions with negatively charged microbia

How does Beta-defensin 131B work?

Has antibacterial activity

What is the research status of Beta-defensin 131B?

Beta-defensin 131B is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 131B?

Beta-defensin 131B has a molecular weight of approximately 8156 g/mol.

Related peptides

Build on Beta-defensin 131B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key