Beta-defensin 131A

experimental

Also known as: Beta-defensin 31, Defensin, beta 131, DEFB131A, P59861

Beta-defensin 131A (DEFB131A) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved beta-sheet structure stabilized by disulfide bonds. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial membrane integrity. Additionally, upon stimulation with lipoteichoic acid—a component of Gram-positive bacterial cell walls—DEFB131A promotes the production and secretion of cytokines and chemokines, indicating a role in modulating innate immune responses and inflammation. Currently classified as experimental, there are no published PubMed references directly investigating DEFB131A. Research on related beta-defensins suggests they act as multifunctional effectors in host defense, but specific functional studies for DEFB131A remain absent. Its potential roles in antimicrobial immunity and immune signaling are inferred from sequence homology and structural similarity to characterized defensins. Given the lack of direct experimental data, clinical relevance for DEFB131A is undefined. Further studies are required to validate its antimicrobial spectrum, immunomodulatory effects, and therapeutic potential. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRVLFFVFGVLSLMFTVPPARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW
Molecular weight
8199 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity (Probable). Upon stimulation with lipoteichoic acid, promotes cytokines and chemokines production and secretion (PubMed:26649771)

Frequently asked questions

What is Beta-defensin 131A?

Beta-defensin 131A (DEFB131A) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved beta-sheet structure stabilized by disulfide bonds. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial membrane integrity. Additionall

How does Beta-defensin 131A work?

Has antibacterial activity (Probable). Upon stimulation with lipoteichoic acid, promotes cytokines and chemokines production and secretion (PubMed:26649771)

What is the research status of Beta-defensin 131A?

Beta-defensin 131A is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 131A?

Beta-defensin 131A has a molecular weight of approximately 8199 g/mol.

Related peptides

Build on Beta-defensin 131A data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key