Beta-defensin 130B

experimental

Also known as: DEFB130B, P0DP73

**Mechanism of Action** Beta-defensin 130B (DEFB130B, UniProt P0DP73) is classified as an antimicrobial host-defense peptide, a member of the beta-defensin family. These peptides typically exert their effects by disrupting microbial cell membranes through electrostatic interactions with negatively charged phospholipids, leading to pore formation and cell lysis. Additionally, beta-defensins may modulate immune responses via chemotactic activity and cytokine regulation, though specific mechanistic details for DEFB130B remain uncharacterized due to limited experimental data. **Key Research Findings** No peer-reviewed studies indexed in PubMed currently exist for DEFB130B. Its identification is based on genomic and proteomic annotations, with predicted structural features common to beta-defensins, including a conserved six-cysteine motif forming three disulfide bridges. Functional validation, antimicrobial spectrum, and in vivo activity have not been experimentally established. The peptide remains in an experimental stage with no published preclinical or clinical data. **Clinical Relevance** Given the absence of research findings, DEFB130B has no established clinical relevance. Its potential as an antimicrobial agent or immunomodulator is speculative. Further studies are required to determine its biological activity, safety, and therapeutic applicability. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP
Molecular weight
8736 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Antimicrobial host-defense peptide. Has an antiplasmodial activity

Frequently asked questions

What is Beta-defensin 130B?

**Mechanism of Action** Beta-defensin 130B (DEFB130B, UniProt P0DP73) is classified as an antimicrobial host-defense peptide, a member of the beta-defensin family. These peptides typically exert their effects by disrupting microbial cell membranes through electrostatic interactions with negatively charged phospholipids

How does Beta-defensin 130B work?

Antimicrobial host-defense peptide. Has an antiplasmodial activity

What is the research status of Beta-defensin 130B?

Beta-defensin 130B is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 130B?

Beta-defensin 130B has a molecular weight of approximately 8736 g/mol.

Related peptides

Build on Beta-defensin 130B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key