Beta-defensin 130A

experimental

Also known as: Beta-defensin 130, Beta-defensin 30, Defensin, beta 130, DEFB130A, P0DP74

Beta-defensin 130A (DEFB130A) is an antimicrobial host-defense peptide encoded by the *DEFB130A* gene. As a member of the beta-defensin family, its proposed mechanism of action involves direct disruption of microbial membranes through electrostatic interactions with negatively charged bacterial lipid bilayers, leading to pore formation and cell lysis. Beta-defensins also exhibit immunomodulatory properties, including chemotactic activity and modulation of inflammatory responses, though specific functional data for DEFB130A remain limited. Current research on DEFB130A is in the experimental stage, with no peer-reviewed studies indexed in PubMed as of the present date. Its characterization is primarily based on genomic and transcriptomic analyses, indicating expression in epithelial tissues. No in vitro or in vivo functional assays have been published, and its antimicrobial spectrum, potency, or physiological roles have not been empirically validated. Given the absence of published research, clinical relevance for DEFB130A is undefined. It remains a candidate for future investigation into innate immune mechanisms or therapeutic development, but no translational applications or safety data exist. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP
Molecular weight
8736 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Antimicrobial host-defense peptide. Has an antiplasmodial activity

Frequently asked questions

What is Beta-defensin 130A?

Beta-defensin 130A (DEFB130A) is an antimicrobial host-defense peptide encoded by the *DEFB130A* gene. As a member of the beta-defensin family, its proposed mechanism of action involves direct disruption of microbial membranes through electrostatic interactions with negatively charged bacterial lipid bilayers, leading

How does Beta-defensin 130A work?

Antimicrobial host-defense peptide. Has an antiplasmodial activity

What is the research status of Beta-defensin 130A?

Beta-defensin 130A is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 130A?

Beta-defensin 130A has a molecular weight of approximately 8736 g/mol.

Related peptides

Build on Beta-defensin 130A data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key