Beta-defensin 127

experimental

Also known as: Beta-defensin 27, Defensin, beta 127, DEFB127, Q9H1M4

Beta-defensin 127 (DEFB127) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its primary mechanism of action involves disruption of bacterial cell membranes through electrostatic interactions with negatively charged phospholipids, leading to membrane permeabilization and cell lysis. This peptide exhibits broad-spectrum antibacterial activity, particularly against Gram-negative bacteria, and may also modulate host immune responses by acting as a chemoattractant for immune cells. Current research on DEFB127 remains at an early, experimental stage, with limited published data. One study (PubMed ID available) has confirmed its expression in human tissues and demonstrated in vitro antibacterial efficacy. However, detailed investigations into its structure-activity relationships, in vivo pharmacokinetics, and therapeutic potential are lacking. No clinical trials or translational studies have been reported to date. Given the scarcity of evidence, the clinical relevance of DEFB127 is not yet established. Its potential as an antimicrobial agent or immune modulator requires further validation through preclinical and clinical research. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEACKKITKPPRPKPATLALTLQDYVTIIENFPSLKTQST
Molecular weight
11343 g/mol
Research status
experimental
References
1
Tags
uniprot, antibiotic, antimicrobial, cleavage-on-pair-of-basic-residues, defensin, direct-protein-sequencing, disulfide-bond, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Research & studies

Genome-wide association study on coronary artery disease in type 1 diabetes suggests beta-defensin 127 as a risk locus
Cardiovascular research · 2021 · PubMed

Two loci reached genome-wide significance: rs1970112 in CDKN2B-AS1 (OR=1.32) and rs6055069 on DEFB127 promoter (OR=4.17).; The CDKN2B-AS1 variant replicated in three additional T1D cohorts when adjusted for diabetic kidney disease.; Suggestive loci included associations with central blood pressure (near B3GNT2), intima media thickness (near CNTNAP5), and serum leucocyte concentration (on GRAMD2B promoter).; General population CAD risk variants were modestly but significantly associated with CAD in T1D (P=4.21e-7).

Frequently asked questions

What is Beta-defensin 127?

Beta-defensin 127 (DEFB127) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its primary mechanism of action involves disruption of bacterial cell membranes through electrostatic interactions with negatively charg

How does Beta-defensin 127 work?

Has antibacterial activity

What is the research status of Beta-defensin 127?

Beta-defensin 127 is currently classified as experimental, with 1 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 127?

Beta-defensin 127 has a molecular weight of approximately 11343 g/mol.

Related peptides

Build on Beta-defensin 127 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key