Beta-defensin 126

experimental

Also known as: Beta-defensin 26, Defensin, beta 126, Epididymal secretory protein 13.2, HBD26, DEFB126, Q9BYW3

**Mechanism of Action** Beta-defensin 126 (DEFB126) is a highly glycosylated, atypical beta-defensin predominantly expressed in the epididymis and secreted onto the sperm surface. Unlike classical defensins with direct antimicrobial activity, DEFB126 functions primarily through its extensive O-glycosylation, which forms a hydrophilic glycocalyx that facilitates sperm migration through cervical mucus by reducing adhesion to mucins. It also modulates the female reproductive tract immune response, potentially protecting sperm from phagocytosis, and is implicated in sperm capacitation and acrosome reaction via interactions with the sperm membrane. **Key Research Findings** Experimental studies demonstrate that DEFB126 deficiency in animal models impairs sperm transport through the female tract, reducing fertility. In humans, polymorphisms in the *DEFB126* gene (e.g., a 2-bp deletion) are associated with reduced sperm penetration of cervical mucus and lower pregnancy rates in natural conception and assisted reproduction. The protein’s glycosylation pattern is critical for function; deglycosylation abolishes its ability to promote sperm motility and mucus penetration. Research remains preclinical, with no clinical trials completed. **Clinical Relevance** DEFB126 is a candidate biomarker for male infertility, particularly in cases of unexplained poor sperm–cervical mucus interaction. Its potential therapeutic applications include supplementing sperm preparations for intrauterine insemination or in vitro fertilization to improve fertilization outcomes. However, all findings are experimental, and no validated clinical tests or treatments exist. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCVPADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG
Molecular weight
12174 g/mol
Research status
experimental
References
20
Tags
uniprot, antibiotic, antimicrobial, cleavage-on-pair-of-basic-residues, defensin, disulfide-bond, fertilization, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte (By similarity). In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation (PubMed:19373462, PubMed:23229569)

Research & studies

Beta-defensin 126 (DEFB126) localization and expression in the sperms and male reproductive tract of the dromedary camel (Camelus dromedarius) during the rutting season
Open veterinary journal · 2025 · PubMed
Roles of Different β-Defensins in the Human Reproductive System: A Review Study
American journal of men's health · 2023 · PubMed

β-defensin 1 prevents bacterial infections in the male reproductive system via CCR6 interaction and aids antitumor immunity in prostate cancer.; β-defensin 1 is necessary for fertilization by facilitating capacitation and acrosome reaction in females.; β-defensin 2 minimizes vaginal infections and may prevent cervical cancer through dendritic cell interactions.; β-defensin 126 is required for sperm motility and protects sperm from immune system factors.

Contributions of seminal plasma proteins to fertilizing ability of bull sperm: A meta-analytical review
Andrologia · 2022 · PubMed
DEFB126 polymorphisms and association with idiopathic asthenozoospermia in China
Asian journal of andrology · 2022 · PubMed
Unusual interplay of contrasting selective pressures on β-defensin genes implicated in male fertility of the Buffalo (Bubalus bubalis)
BMC evolutionary biology · 2019 · PubMed
Recombinant β-defensin 126 promotes bull sperm binding to bovine oviductal epithelia
Reproduction, fertility, and development · 2018 · PubMed

Recombinant BBD126 significantly increased binding of epididymal and ejaculated sperm to BOEC explants.; Anti-BBD126 antibody blocked the BBD126-mediated increase in sperm binding capacity.; Recombinant BBD126 reduced corpus sperm agglutination.; Sperm with more BBD126 may have greater oviduct binding capacity.

Cauda Epididymis-Specific Beta-Defensin 126 Promotes Sperm Motility but Not Fertilizing Ability in Cattle
Biology of reproduction · 2016 · PubMed
Sperm-Coating Beta-Defensin 126 Is a Dissociation-Resistant Dimer Produced by Epididymal Epithelium in the Bovine Reproductive Tract
Biology of reproduction · 2016 · PubMed

BBD126 forms a dimer highly resistant to standard dissociation methods.; BBD126 is expressed by epithelial cells of the caudal epididymis and vas deferens in both mature and immature bulls.; BBD126 coats caudal sperm, with staining concentrated on the sperm tail.; Significant sequence conservation at the N-terminus but differences at the C-terminus imply species-specific roles.

Frequently asked questions

What is Beta-defensin 126?

**Mechanism of Action** Beta-defensin 126 (DEFB126) is a highly glycosylated, atypical beta-defensin predominantly expressed in the epididymis and secreted onto the sperm surface. Unlike classical defensins with direct antimicrobial activity, DEFB126 functions primarily through its extensive O-glycosylation, which form

How does Beta-defensin 126 work?

Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial

What is the research status of Beta-defensin 126?

Beta-defensin 126 is currently classified as experimental, with 20 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 126?

Beta-defensin 126 has a molecular weight of approximately 12174 g/mol.

Related peptides

Build on Beta-defensin 126 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key