Beta-defensin 124

experimental

Also known as: Beta-defensin 24, Defensin, beta 124, DEFB124, Q8NES8

Beta-defensin 124 (DEFB124) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent microbial killing. As a cationic peptide, it is thought to bind to negatively charged phospholipids on bacterial surfaces, integrating into the lipid bilayer and forming pores that compromise membrane integrity. This mechanism is typical of defensins, which exhibit broad-spectrum activity against Gram-positive and Gram-negative bacteria. Currently, no peer-reviewed research findings are available in PubMed for Beta-defensin 124, and its status remains experimental. The lack of published studies indicates that its specific antimicrobial spectrum, potency, and in vivo functions have not been characterized. It is possible that DEFB124 is a predicted or poorly expressed gene product, with no validated experimental data on its expression, regulation, or biological activity in human tissues. Given the absence of research data, the clinical relevance of Beta-defensin 124 is undefined. It has no established role in human immunity or disease, and no therapeutic applications have been explored. Further investigation is required to confirm its expression, antimicrobial activity, and potential utility as an antibiotic agent or biomarker. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MTQLLLFLVALLVLGHVPSGRSEFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE
Molecular weight
8058 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 124?

Beta-defensin 124 (DEFB124) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequen

How does Beta-defensin 124 work?

Has antibacterial activity

What is the research status of Beta-defensin 124?

Beta-defensin 124 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 124?

Beta-defensin 124 has a molecular weight of approximately 8058 g/mol.

Related peptides

Build on Beta-defensin 124 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key