Beta-defensin 123

experimental

Also known as: Beta-defensin 23, Defensin, beta 123, DEFB123, Q8N688

Beta-defensin 123 (DEFB123) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif forming three disulfide bridges. Its mechanism of action involves disruption of bacterial cell membranes via electrostatic interactions with negatively charged phospholipids, leading to pore formation, membrane permeabilization, and subsequent bacterial lysis. This activity is primarily directed against Gram-positive and Gram-negative bacteria, with potential immunomodulatory roles including chemotaxis and cytokine regulation. Current research on DEFB123 remains at an experimental stage, with only five PubMed-indexed studies available. Key findings indicate its expression in epithelial tissues and its in vitro bactericidal effects against pathogens such as *Escherichia coli* and *Staphylococcus aureus*. Limited data suggest possible synergy with other host defense peptides, but no in vivo efficacy or structural-functional studies have been published. The peptide's role in human disease or therapeutic applications has not been established. Clinical relevance is minimal at this stage, as DEFB123 has not advanced beyond preclinical characterization. Its potential as an antimicrobial agent or immune modulator remains speculative, requiring further validation in infection models and safety assessments. No clinical trials or translational studies are currently reported. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKLLLLTLTVLLLLSQLTPGGTQRCWNLYGKCRYRCSKKERVYVYCINNKMCCVKPKYQPKERWWPF
Molecular weight
8105 g/mol
Research status
experimental
References
5
Tags
uniprot, alternative-splicing, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Research & studies

Exploring Sertoli Cells' Innate Bulwark Role Against Infections: In Vitro Performances on Candida tropicalis Biofilms
Cells · 2025 · PubMed
Yak DEFB123 alleviates lung injury caused by Klebsiella pneumoniae through MAPKs signaling pathway
Veterinary microbiology · 2024 · PubMed

rDEFB123 inhibits E. coli, K. pneumoniae, and S. aureus growth.; rDEFB123 enhances macrophage phagocytic activity.; rDEFB123 reduces serum ALT/AST and increases IFN-γ and IgG in infected mice.; rDEFB123 downregulates JNK, TRAF2, TRAF6, MIF, IL-1 genes and p-JNK protein in mouse lungs.

Multi-Protease Strategy Identifies Three PE2 Missing Proteins in Human Testis Tissue
Journal of proteome research · 2017 · PubMed

Nonconventional proteases (LysargiNase, GluC) improved peptide diversity and sequence coverage compared to trypsin.; Three PE2 missing proteins were identified: beta-defensin 123 (Q8N688), cancer/testis antigen family 45 member A10 (P0DMU9), and Histone H2A-Bbd type 2/3 (P0C5Z0).; Beta-defensin 123 and Histone H2A-Bbd type 2/3 each had only one unique peptide (9 AA), falling under HPP Guidelines v2.1 exceptions.; Validation included spectrum quality checks, isobaric PTM and SAAV filtering, synthetic peptide verification, and overlapping peptides from different proteases.

Directed alteration of a novel bovine beta-defensin to improve antimicrobial efficacy against methicillin-resistant Staphylococcus aureus (MRSA)
International journal of antimicrobial agents · 2008 · PubMed

All four peptide modifications significantly increased antimicrobial activity against MRSA compared to native bovine beta-defensin 123 (P=0.02).; Conferring a hydrophilic C-terminal tail caused the most significant increase in activity against MRSA, with an LD50 of 3.91 μg/mL.; Increased charge at positively selected sites showed the most significant increase in activity against a non-resistant S. aureus strain (P=0.02).; Informed amino acid modifications can significantly affect peptide specificity and antimicrobial efficacy.

Evolution, expression and effectiveness in a cluster of novel bovine beta-defensins
Immunogenetics · 2008 · PubMed

Frequently asked questions

What is Beta-defensin 123?

Beta-defensin 123 (DEFB123) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif forming three disulfide bridges. Its mechanism of action involves disruption of bacterial cell membranes via electrostatic interactions with negatively charged phospholipids, le

How does Beta-defensin 123 work?

Has antibacterial activity

What is the research status of Beta-defensin 123?

Beta-defensin 123 is currently classified as experimental, with 5 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 123?

Beta-defensin 123 has a molecular weight of approximately 8105 g/mol.

Related peptides

Build on Beta-defensin 123 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key