Beta-defensin 121

experimental

Also known as: Beta-defensin 21, Defensin, beta 121, DEFB121, Q5J5C9

Beta-defensin 121 (DEFB121) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent cell lysis. This cationic peptide is thought to target negatively charged microbial membranes, exhibiting broad-spectrum antibacterial activity, though specific molecular targets or pathways remain uncharacterized due to limited experimental data. As of the current research status (EXPERIMENTAL), no peer-reviewed studies indexed in PubMed are available for Beta-defensin 121. The peptide is predicted based on genomic sequence homology to other beta-defensins, but functional validation through in vitro or in vivo assays has not been reported. Its expression patterns, potency against specific pathogens, and potential synergy with other immune factors remain unknown. Given the absence of published research, clinical relevance for Beta-defensin 121 is not established. It may represent a candidate for future antimicrobial development, but no translational applications or therapeutic roles have been investigated. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV
Molecular weight
8456 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 121?

Beta-defensin 121 (DEFB121) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved beta-sheet structure stabilized by three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequen

How does Beta-defensin 121 work?

Has antibacterial activity

What is the research status of Beta-defensin 121?

Beta-defensin 121 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 121?

Beta-defensin 121 has a molecular weight of approximately 8456 g/mol.

Related peptides

Build on Beta-defensin 121 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key