Beta-defensin 119

experimental

Also known as: Beta-defensin 120, Beta-defensin 19, Beta-defensin 20, Defensin, beta 119, Defensin, beta 120, ESC42-RELA, DEFB119, Q8N690

Beta-defensin 119 (DEFB119), also referred to as beta-defensin 120, beta-defensin 19, beta-defensin 20, or ESC42-RELA, is an antimicrobial peptide encoded by the DEFB119 gene. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial cell membranes, a characteristic shared with other beta-defensins. These peptides are typically cationic and amphipathic, enabling them to interact with negatively charged bacterial membranes, leading to pore formation and cell lysis. However, specific structural or functional details for DEFB119 remain uncharacterized in published literature. As of the current research status (EXPERIMENTAL), no peer-reviewed studies indexed in PubMed have been identified for DEFB119. The absence of published data suggests that its antibacterial properties are inferred from sequence homology or preliminary in silico predictions rather than validated experimental evidence. Further investigation is required to confirm its spectrum of activity, potency, and potential synergy with other immune effectors. Given the lack of clinical studies, the therapeutic relevance of DEFB119 is speculative. It may represent a candidate for future antimicrobial development, particularly in the context of drug-resistant infections, but no translational data exist. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
Molecular weight
9822 g/mol
Research status
experimental
Tags
uniprot, alternative-splicing, antibiotic, antimicrobial, defensin, disulfide-bond, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 119?

Beta-defensin 119 (DEFB119), also referred to as beta-defensin 120, beta-defensin 19, beta-defensin 20, or ESC42-RELA, is an antimicrobial peptide encoded by the DEFB119 gene. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial cell membranes, a characteristic

How does Beta-defensin 119 work?

Has antibacterial activity

What is the research status of Beta-defensin 119?

Beta-defensin 119 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 119?

Beta-defensin 119 has a molecular weight of approximately 9822 g/mol.

Related peptides

Build on Beta-defensin 119 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key