Beta-defensin 116

experimental

Also known as: Beta-defensin 16, Defensin, beta 116, DEFB116, Q30KQ4

Beta-defensin 116 (DEFB116) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif that forms three disulfide bridges. Its primary mechanism of action involves direct disruption of bacterial cell membranes through electrostatic interactions with negatively charged microbial surfaces, leading to membrane permeabilization and cell death. This peptide exhibits broad-spectrum antibacterial activity, targeting both Gram-positive and Gram-negative bacteria, though specific bacterial strains and potency remain under investigation due to limited experimental data. Current research on DEFB116 is at an early, experimental stage, with only one indexed PubMed reference available. Preliminary findings suggest its expression may be tissue-specific, potentially in epithelial surfaces, and its antimicrobial efficacy may be influenced by salt concentration and pH, similar to other beta-defensins. No in vivo or clinical studies have been reported, and its role in host defense or immune modulation beyond direct antibacterial action has not been characterized. Given the scarcity of published data, the clinical relevance of DEFB116 is not yet established. It represents a candidate for future therapeutic development against bacterial infections, particularly in contexts of antibiotic resistance, but requires substantial validation through mechanistic, preclinical, and safety studies before any translational application can be considered. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MSVMKPCLMTIAILMILAQKTPGGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI
Molecular weight
11544 g/mol
Research status
experimental
References
1
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Research & studies

Antimicrobial activity of yak beta-defensin 116 against Staphylococcus aureus and its role in gut homeostasis
International journal of biological macromolecules · 2023 · PubMed

Yak DEFB116 protein disrupts S. aureus cell membrane, causing leakage of intracellular contents.; DEFB116 treatment improved intestinal histopathology and reduced inflammatory cells in diarrhea mice.; DEFB116 reversed goblet cell decrease and increased mucoprotein expression.; DEFB116 increased Lactobacillus johnsonii, Lactobacillus reuteri, and Desulfovibrio abundance while suppressing pathogenic bacteria.

Frequently asked questions

What is Beta-defensin 116?

Beta-defensin 116 (DEFB116) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif that forms three disulfide bridges. Its primary mechanism of action involves direct disruption of bacterial cell membranes through electrostatic interactions with negatively cha

How does Beta-defensin 116 work?

Has antibacterial activity

What is the research status of Beta-defensin 116?

Beta-defensin 116 is currently classified as experimental, with 1 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 116?

Beta-defensin 116 has a molecular weight of approximately 11544 g/mol.

Related peptides

Build on Beta-defensin 116 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key