Beta-defensin 115

experimental

Also known as: Beta-defensin 15, Defensin, beta 115, DEFB115, Q30KQ5

Beta-defensin 115 (DEFB115) is a member of the beta-defensin family, a group of antimicrobial peptides primarily involved in innate immune defense. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent microbial killing. Like other defensins, it is thought to exert broad-spectrum antibacterial activity through electrostatic attraction to negatively charged microbial surfaces, followed by pore formation or membrane destabilization. However, specific structural and functional details for DEFB115 remain uncharacterized. As of current literature, no peer-reviewed research studies have been published on DEFB115 (PubMed references: 0). Its classification as an experimental peptide suggests that its expression, antimicrobial spectrum, and in vivo roles have not been empirically validated. The absence of published data limits any assessment of its potency, selectivity, or potential therapeutic applications. Given the lack of experimental evidence, the clinical relevance of beta-defensin 115 is currently undefined. It remains a hypothetical antimicrobial agent, with no translational studies or clinical trials reported. Further research is required to confirm its activity, safety, and utility in infectious disease contexts. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
Molecular weight
10071 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 115?

Beta-defensin 115 (DEFB115) is a member of the beta-defensin family, a group of antimicrobial peptides primarily involved in innate immune defense. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent microbial killing. Like other defe

How does Beta-defensin 115 work?

Has antibacterial activity

What is the research status of Beta-defensin 115?

Beta-defensin 115 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 115?

Beta-defensin 115 has a molecular weight of approximately 10071 g/mol.

Related peptides

Build on Beta-defensin 115 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key