Beta-defensin 114

experimental

Also known as: Beta-defensin 14, Defensin, beta 114, DEFB114, Q30KQ6

Beta-defensin 114 (DEFB114) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif that forms three disulfide bridges. Its mechanism of action involves salt-sensitive disruption of microbial membranes, exhibiting broad-spectrum activity against Gram-negative bacteria (e.g., *Escherichia coli*), Gram-positive bacteria (e.g., *Staphylococcus aureus*), and fungi (e.g., *Candida albicans*). The salt sensitivity suggests its antimicrobial efficacy may be modulated by ionic conditions, a common feature among defensins that can influence activity in physiological environments. Current research on DEFB114 remains at an experimental stage, with limited published data. The single PubMed reference indicates preliminary characterization of its antimicrobial properties, but no in vivo or clinical studies have been reported. Key findings focus on its in vitro activity spectrum and salt-dependent behavior, which may inform future investigations into its role in host defense and potential therapeutic applications. Clinical relevance is not yet established due to the scarcity of translational research. Further studies are needed to evaluate its safety, stability, and efficacy in relevant models before considering applications in infectious disease management. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTEKLYEEDDMF
Molecular weight
8318 g/mol
Research status
experimental
References
1
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has a salt-sensitive antimicrobial activity against Gram-negative bacteria, including E.coli, Gram-positive, including S.aureus, and fungi, including C.albicans. Binds to and neutralizes bacterial lipopolysaccharides (LPS), abolishing TNF production by macrophages challenged with LPS. Rescues the LPS-induced reduction of sperm motility in vitro and may protect from LPS-induced lethality

Research & studies

Differential expression, molecular cloning, and characterization of porcine beta defensin 114
Journal of animal science and biotechnology · 2019 · PubMed

PBD114 was highly expressed in intestine, liver, spleen, and thymus, with higher levels in Tibetan pigs than DLY pigs.; Expression significantly increased after E. coli K88 challenge.; Recombinant PBD114 showed antimicrobial activity against E. coli DH5 and K88 with MICs of 64 and 128 μg/mL.; rPBD114 did not affect cell viability at physiological concentrations.

Frequently asked questions

What is Beta-defensin 114?

Beta-defensin 114 (DEFB114) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif that forms three disulfide bridges. Its mechanism of action involves salt-sensitive disruption of microbial membranes, exhibiting broad-spectrum activity against Gram-negative b

How does Beta-defensin 114 work?

Has a salt-sensitive antimicrobial activity against Gram-negative bacteria, including E.coli, Gram-positive, including S.aureus, and fungi, including C.albicans. Binds to and neutralizes bacterial lipopolysaccharides (LPS), abolishing TNF production by macrophages challenged with LPS. Rescues the LPS-induced reduction of sperm motility in vitro and may protect from LPS-induced lethality

What is the research status of Beta-defensin 114?

Beta-defensin 114 is currently classified as experimental, with 1 research references on record. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 114?

Beta-defensin 114 has a molecular weight of approximately 8318 g/mol.

Related peptides

Build on Beta-defensin 114 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key