Beta-defensin 113

experimental

Also known as: Beta-defensin 13, Defensin, beta 113, DEFB113, Q30KQ7

Beta-defensin 113 (DEFB113) is a member of the beta-defensin family, a group of antimicrobial peptides primarily expressed in epithelial tissues. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent microbial killing. This activity is typical of defensins, which are cationic and amphipathic, allowing them to bind to negatively charged bacterial surfaces and form pores or destabilize the lipid bilayer. Currently, DEFB113 is classified as an experimental peptide with no published research studies indexed in PubMed. Its functional characterization is inferred from sequence homology to other beta-defensins, such as DEFB1 and DEFB4, which have demonstrated broad-spectrum antibacterial activity. No specific in vitro or in vivo data are available to confirm its antimicrobial efficacy, target specificity, or expression patterns in human tissues. Given the absence of direct experimental evidence, the clinical relevance of DEFB113 remains undefined. It has not been investigated in therapeutic contexts, and no translational applications have been proposed. Further research is required to validate its biological activity and potential utility in infectious disease or immune modulation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKPIINKITSKLHQK
Molecular weight
9640 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 113?

Beta-defensin 113 (DEFB113) is a member of the beta-defensin family, a group of antimicrobial peptides primarily expressed in epithelial tissues. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent microbial killing. This activity is

How does Beta-defensin 113 work?

Has antibacterial activity

What is the research status of Beta-defensin 113?

Beta-defensin 113 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 113?

Beta-defensin 113 has a molecular weight of approximately 9640 g/mol.

Related peptides

Build on Beta-defensin 113 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key