Beta-defensin 112

experimental

Also known as: Beta-defensin 12, Defensin, beta 112, DEFB112, Q30KQ8

**Mechanism of Action** Beta-defensin 112 (DEFB112) is a predicted member of the beta-defensin family, a group of cationic antimicrobial peptides. Its proposed mechanism involves disruption of microbial membranes via electrostatic interactions with negatively charged bacterial phospholipids, leading to pore formation, membrane permeabilization, and cell lysis. This activity is typical of defensins, which also exhibit immunomodulatory properties, though specific functional data for DEFB112 remain uncharacterized. **Key Research Findings** No peer-reviewed studies or PubMed-indexed publications currently exist for Beta-defensin 112. Its classification as "EXPERIMENTAL" indicates that its sequence (UniProt Q30KQ8) has been identified through genomic or computational predictions, but functional validation—including antibacterial efficacy, target specificity, or in vivo activity—has not been experimentally confirmed. The absence of research data precludes any assessment of potency, spectrum, or safety. **Clinical Relevance** Without experimental evidence, Beta-defensin 112 has no established clinical relevance. Its potential as an antimicrobial agent remains hypothetical, and no therapeutic applications, diagnostic uses, or biomarker roles have been investigated. Further studies are required to determine if it possesses biological activity comparable to other beta-defensins. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKLLTTICRLKLEKMYSKTNTSSTIFEKARHGTEKISTARSEGHHITFSRWKSCTAIGGRCKNQCDDSEFRISYCARPTTHCCVTECDPTDPNNWIPKDSVGTQEWYPKDSRH
Molecular weight
12991 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 112?

**Mechanism of Action** Beta-defensin 112 (DEFB112) is a predicted member of the beta-defensin family, a group of cationic antimicrobial peptides. Its proposed mechanism involves disruption of microbial membranes via electrostatic interactions with negatively charged bacterial phospholipids, leading to pore formation,

How does Beta-defensin 112 work?

Has antibacterial activity

What is the research status of Beta-defensin 112?

Beta-defensin 112 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 112?

Beta-defensin 112 has a molecular weight of approximately 12991 g/mol.

Related peptides

Build on Beta-defensin 112 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key