Beta-defensin 110

experimental

Also known as: Beta-defensin 10, Beta-defensin 11, Beta-defensin 111, Defensin, beta 110, Defensin, beta 111, DEFB110, Q30KQ9

Beta-defensin 110 (DEFB110) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved six-cysteine motif that forms three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent microbial killing. As a cationic peptide, it is thought to preferentially bind to negatively charged bacterial membranes, inducing pore formation or membrane destabilization, though specific molecular targets remain uncharacterized. Currently, beta-defensin 110 is classified as an experimental peptide with no published PubMed-indexed research studies. Its functional characterization is inferred primarily from sequence homology to other beta-defensins, such as DEFB1 and DEFB4, which exhibit broad-spectrum antibacterial activity against Gram-positive and Gram-negative bacteria. No in vitro, in vivo, or clinical data are available to confirm its specific antimicrobial spectrum, potency, or physiological role. Given the absence of direct experimental evidence, the clinical relevance of beta-defensin 110 remains undefined. It has not been investigated in any therapeutic or diagnostic context, and no safety, efficacy, or pharmacokinetic data exist. Further research is required to validate its proposed antibacterial activity and explore potential applications in infectious disease or immune modulation. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MKIQLFFFILHFWVTILPAKKKYPEYGSLDLRRECRIGNGQCKNQCHENEIRIAYCIRPGTHCCLQQ
Molecular weight
8001 g/mol
Research status
experimental
Tags
uniprot, alternative-splicing, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 110?

Beta-defensin 110 (DEFB110) is a member of the beta-defensin family of antimicrobial peptides, characterized by a conserved six-cysteine motif that forms three disulfide bridges. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane disruption and subsequent mic

How does Beta-defensin 110 work?

Has antibacterial activity

What is the research status of Beta-defensin 110?

Beta-defensin 110 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 110?

Beta-defensin 110 has a molecular weight of approximately 8001 g/mol.

Related peptides

Build on Beta-defensin 110 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key