Beta-defensin 109B

experimental

Also known as: Defensin beta 109B, DEFB109B, Q30KR1

Beta-defensin 109B (DEFB109B, Q30KR1) is an experimental antimicrobial peptide belonging to the beta-defensin family, which are characterized by a conserved beta-sheet structure stabilized by three disulfide bonds. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane permeabilization and disruption of microbial integrity. As a cationic peptide, it is thought to bind to negatively charged bacterial phospholipids, forming pores or causing membrane thinning, ultimately resulting in bacterial cell death. This mechanism is typical of defensins, which also exhibit immunomodulatory properties, though specific functional data for DEFB109B remain limited. Currently, no peer-reviewed research publications are indexed in PubMed for DEFB109B, indicating that its characterization is at a very early, pre-clinical stage. The peptide has been identified through genomic and transcriptomic analyses, but its expression patterns, antimicrobial spectrum, and in vivo activity have not been experimentally validated. Without published studies, its potency against specific pathogens, cytotoxicity to host cells, and potential therapeutic applications remain speculative. Given the absence of experimental data, DEFB109B has no established clinical relevance at this time. It represents a candidate for future investigation into novel antimicrobial agents, particularly in the context of rising antibiotic resistance. However, its transition from an experimental peptide to a clinically useful compound would require extensive in vitro and in vivo studies to confirm safety and efficacy. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRLHLLLLILLLFSILLSPVRGGLGPAEGHCLNLFGVCRTDVCNIVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKPNLK
Molecular weight
9886 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 109B?

Beta-defensin 109B (DEFB109B, Q30KR1) is an experimental antimicrobial peptide belonging to the beta-defensin family, which are characterized by a conserved beta-sheet structure stabilized by three disulfide bonds. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to me

How does Beta-defensin 109B work?

Has antibacterial activity

What is the research status of Beta-defensin 109B?

Beta-defensin 109B is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 109B?

Beta-defensin 109B has a molecular weight of approximately 9886 g/mol.

Related peptides

Build on Beta-defensin 109B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key