Beta-defensin 108B

experimental

Also known as: Beta-defensin 8, Defensin, beta 108, Defensin, beta 108B, DEFB108B, Q8NET1

Beta-defensin 108B (DEFB108B) is a predicted member of the beta-defensin family, characterized by a conserved six-cysteine motif that forms three disulfide bridges, a structural hallmark for antimicrobial peptides. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to membrane permeabilization and disruption of microbial integrity. However, unlike well-characterized beta-defensins (e.g., DEFB1, DEFB4A), DEFB108B has not been experimentally validated for antibacterial activity, and its functional role remains inferred from sequence homology. As of current literature, no peer-reviewed research findings have been published on DEFB108B. The gene is annotated in genomic databases but lacks experimental evidence for expression, antimicrobial efficacy, or physiological relevance. Its classification as "experimental" reflects a hypothetical status, with no in vitro or in vivo studies confirming its proposed mechanism or biological activity. Given the absence of published data, DEFB108B has no established clinical relevance. It remains a candidate for future investigation into host defense peptides, but its potential therapeutic applications are entirely speculative. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTPKKD
Molecular weight
8326 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 108B?

Beta-defensin 108B (DEFB108B) is a predicted member of the beta-defensin family, characterized by a conserved six-cysteine motif that forms three disulfide bridges, a structural hallmark for antimicrobial peptides. Its proposed mechanism of action involves direct interaction with bacterial cell membranes, leading to me

How does Beta-defensin 108B work?

Has antibacterial activity

What is the research status of Beta-defensin 108B?

Beta-defensin 108B is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 108B?

Beta-defensin 108B has a molecular weight of approximately 8326 g/mol.

Related peptides

Build on Beta-defensin 108B data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key