Beta-defensin 106

experimental

Also known as: Beta-defensin 6, Defensin, beta 106, DEFB106A, DEFB106B, Q8N104

Beta-defensin 106 (DEFB106A/B) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif forming three disulfide bridges. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial membrane integrity. Additionally, it functions as a ligand for the C-C chemokine receptor CCR2, suggesting a role in chemotaxis and immune modulation by recruiting leukocytes to sites of infection or inflammation. Currently classified as experimental, no peer-reviewed research findings are indexed in PubMed, indicating a lack of published in vitro, in vivo, or clinical studies. The dual antimicrobial and chemokine receptor-binding properties imply potential relevance in host defense and inflammatory regulation, but the absence of data precludes assessment of efficacy, safety, or therapeutic applications. Clinical relevance remains undefined due to the experimental status and absence of published evidence. Further investigation is required to characterize its biological functions and potential utility in infectious or inflammatory diseases. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID
Molecular weight
7369 g/mol
Research status
experimental
Tags
uniprot, 3d-structure, antibiotic, antimicrobial, defensin, disulfide-bond, membrane, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity (PubMed:12600824). Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:23938203)

Frequently asked questions

What is Beta-defensin 106?

Beta-defensin 106 (DEFB106A/B) is an antimicrobial peptide belonging to the beta-defensin family, characterized by a conserved six-cysteine motif forming three disulfide bridges. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial membrane integrity. Additional

How does Beta-defensin 106 work?

Has antibacterial activity (PubMed:12600824). Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:23938203)

What is the research status of Beta-defensin 106?

Beta-defensin 106 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 106?

Beta-defensin 106 has a molecular weight of approximately 7369 g/mol.

Related peptides

Build on Beta-defensin 106 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key