Beta-defensin 105

experimental

Also known as: Beta-defensin 5, Defensin, beta 105, DEFB105A, DEFB105B, Q8NG35

Beta-defensin 105 (DEFB105), also referred to as beta-defensin 5, is an antimicrobial peptide encoded by the *DEFB105A* and *DEFB105B* genes. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial membrane integrity, a common feature among defensins. As a cationic peptide, it is predicted to interact with negatively charged bacterial membranes, leading to pore formation and cell lysis. However, detailed mechanistic studies specific to DEFB105 remain limited. Current research on DEFB105 is at an experimental stage, with no peer-reviewed PubMed references available as of this writing. The peptide's functional characterization is largely inferred from homology to other beta-defensins, which exhibit broad-spectrum antimicrobial properties and immunomodulatory roles. Its expression patterns and physiological significance in host defense have not been empirically validated in published studies. Given the absence of published data, the clinical relevance of DEFB105 is undefined. It has not been investigated in therapeutic contexts, and no translational applications have been proposed. Further experimental work is required to confirm its antimicrobial spectrum, in vivo activity, and potential utility in infection or inflammatory disease models. For research purposes only — not medical advice.

Key data

Category
Immune Modulation
Sequence
MALIRKTFYFLFAMFFILVQLPSGCQAGLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI
Molecular weight
8923 g/mol
Research status
experimental
Tags
uniprot, antibiotic, antimicrobial, defensin, disulfide-bond, proteomics-identification, reference-proteome, secreted, signal

Mechanism of action

Has antibacterial activity

Frequently asked questions

What is Beta-defensin 105?

Beta-defensin 105 (DEFB105), also referred to as beta-defensin 5, is an antimicrobial peptide encoded by the *DEFB105A* and *DEFB105B* genes. Its primary mechanism of action involves direct antibacterial activity, likely through disruption of microbial membrane integrity, a common feature among defensins. As a cationic

How does Beta-defensin 105 work?

Has antibacterial activity

What is the research status of Beta-defensin 105?

Beta-defensin 105 is currently classified as experimental. This is for research purposes only and is not medical advice.

What is the molecular weight of Beta-defensin 105?

Beta-defensin 105 has a molecular weight of approximately 8923 g/mol.

Related peptides

Build on Beta-defensin 105 data programmatically

Structured peptide data, semantic search, and AI summaries via one API.

Get a free API key